Os10t0500700-01

Locus

Os10g0500700

Description

Glutaredoxin, Drought stress response

RAP-DB Gene Symbol Synonym(s)

OsGRXS17

RAP-DB Gene Name Synonym(s)

Glutaredoxin 17

CGSNL Gene Symbol

GRX22

CGSNL Gene Name

GLUTAREDOXIN 22

Oryzabase Gene Symbol Synonym(s)

OsGRX22, OsGRXS17, GRXS17

Oryzabase Gene Name Synonym(s)

glutaredoxin 22, Glutaredoxin S17

Transcript Evidence

AK059628

AK067982

Protein Evidence

Q0IWL9

Literature

PMID: 29162892

Note

Manual Curation

December 12, 2017

Gene Ontology (GO)

Biological Process: cell redox homeostasis (GO:0045454)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)

Functional domain (InterPro)

Thioredoxin-like superfamily (IPR036249)

Monothiol glutaredoxin-related (IPR004480)

Thioredoxin domain (IPR013766)

Glutaredoxin (IPR002109)

Glutaredoxin, PICOT-like (IPR033658)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

nucleus (GO:0005634)

Full-length cDNA

001-030-H12 (Online Clone Ordering)

J013121J12 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0500700-01)

RiceXPro (AK059628)

Others

Oryzabase (13583)

KEGG (Os10t0500700-01)

Transcript

1815 bp

>Os10t0500700-01 Glutaredoxin, Drought stress response
AAAAGGAAAGCAGAGGAAAACCCCAAGCCGCAAGCCCCCCCGCCGCGAGTCGTCTTCTCA
TCTCTCCTCCGCCGCCGCCGCCTGCTGCTGCATCTCTCGTCGTCGCCGGTGAGGGAAGGG
AGGGGAGGGGGGAGGGCGTGATGGCGGCGGTGAGGGAGGTGGGGTCGAAGGCGGAGCTGG
AGGCGGCGGCGGGAGGGGCGCGGGCCGCCGCGGTGCACTTCTGGGCGGCGTGGTGCGAGG
CGTCCAAGCAGATGGACGAGGTCTTCGCGCACCTCGCCGTCGACTTCTCCCACGCCGTCT
TCCTCCGGGTTGAAGCTGAGGAACAACCCGAAATTTCAGAGGCATATGGAGTTACAGCAG
TGCCATATTTTGTTTTCTTGAAGGAAGGTAAAACTGTTGATACTCTGGAGGGTGCAAATC
CAGCCAGCTTGGCCAATAAGGTTGCAAAGTTAGCTGGGCCTGCCAGCGTTGCTGAGTCTG
CTGTGCCTGCTAGCCTGGGTGTGGCTGCTGGGCCTGCTGTACTTGAAAAGGTTCAAGAGA
TGGCACAGCAAAATGGAGCTTCTGCCACTAGTAGTGCAGAAGATGCATTGAACAAGAGAT
TGGAGCAGCTTGTCAATTCCCATCCCGTCTTCTTATTTATGAAGGGAACCCCTGAGCAAC
CAAGGTGTGGTTTCAGTCGAAAAGTAGTTGACGTTTTGAAGCAGGAAGGAGTTGAATTTG
GGAGCTTTGACATCCTAACAGATAACGATGTACGTGAAGGAATGAAAAAGTTCTCAAACT
GGCCGACTTTTCCTCAGCTCTACTGCAAAGGTGAGCTGCTTGGTGGATGTGATATTGTGA
TTGCTATGCATGAAAGCGGTGAACTGAAGGATGTTTTTAAGGAGCACAACATTCCGCTGC
AGCCACAGGGAAGCAAAAACGAGGAGGCAGTGAAAGCCAAGCCTGATACTGAGAAGAGTG
GTGCAGTTTCTGAACCAGCTTTGCTTACTGCAGCTCAGAAGGAACGCTTGGAAAGCCTTG
TTAATTTCAGCACAGTGATGGCATTTATAAAAGGTACACCTGAGGAGCCCAAGTGTGGAT
TCAGTGGAAAACTAGTGCATATTCTTAAGCAAGAGAAGATCCCTTTCTCAAGTTTTGACA
TTCTTACGGATGATGAGGTTAGGCAGGGTCTAAAGCTTCTCTCAAACTGGCCTAGTTACC
CTCAACTGTACATAAACGGTGAACTGGTTGGCGGATCAGACATTGTTATGGAGATGCATA
AGAGTGGGGAGCTTAAGAAGGTTCTATCTGAGAAAGGGATCGTTGCGAAAGAAAGTCTAG
AAGACCGCCTGAAGGCCCTGATTTCCTCTGCCCCAGTGATGCTCTTCATGAAGGGCACCC
CAGATGCCCCCCGCTGCGGCTTCAGTTCGAAGGTTGTGAATGCACTGAAGCAAGCAGGAG
TCAGCTTCGGAGCGTTCGACATCCTATCCGACGAGGAGGTTAGGCAAGGCTTGAAGACGT
ACTCCAACTGGCCCACGTTCCCTCAGCTGTACTACAAATCAGAACTGATTGGAGGCTGTG
ACATCGTTCTTGAGCTGGAGAAGAGTGGAGAGCTGAAGTCCACGCTTTCGGAGTGAGGAA
AATTTACCGTCGTATCCGCATCTTCCTCTTCCTGGTGTTTCTACCATCCGTCGACCATCG
AGTTTGCTCTATTGATGGCATTTTCTTGTATTCATAGATCCGTATTTCAAACTTAGATAT
ATGCCTGTGCCACATCGCTTTTAACTGTGACATCTGCAGAAGAATAACTAAGACGACCTG
TTCAGTACGGCTAAT

CDS

1476 bp

>Os10t0500700-01 Glutaredoxin, Drought stress response
ATGGCGGCGGTGAGGGAGGTGGGGTCGAAGGCGGAGCTGGAGGCGGCGGCGGGAGGGGCG
CGGGCCGCCGCGGTGCACTTCTGGGCGGCGTGGTGCGAGGCGTCCAAGCAGATGGACGAG
GTCTTCGCGCACCTCGCCGTCGACTTCTCCCACGCCGTCTTCCTCCGGGTTGAAGCTGAG
GAACAACCCGAAATTTCAGAGGCATATGGAGTTACAGCAGTGCCATATTTTGTTTTCTTG
AAGGAAGGTAAAACTGTTGATACTCTGGAGGGTGCAAATCCAGCCAGCTTGGCCAATAAG
GTTGCAAAGTTAGCTGGGCCTGCCAGCGTTGCTGAGTCTGCTGTGCCTGCTAGCCTGGGT
GTGGCTGCTGGGCCTGCTGTACTTGAAAAGGTTCAAGAGATGGCACAGCAAAATGGAGCT
TCTGCCACTAGTAGTGCAGAAGATGCATTGAACAAGAGATTGGAGCAGCTTGTCAATTCC
CATCCCGTCTTCTTATTTATGAAGGGAACCCCTGAGCAACCAAGGTGTGGTTTCAGTCGA
AAAGTAGTTGACGTTTTGAAGCAGGAAGGAGTTGAATTTGGGAGCTTTGACATCCTAACA
GATAACGATGTACGTGAAGGAATGAAAAAGTTCTCAAACTGGCCGACTTTTCCTCAGCTC
TACTGCAAAGGTGAGCTGCTTGGTGGATGTGATATTGTGATTGCTATGCATGAAAGCGGT
GAACTGAAGGATGTTTTTAAGGAGCACAACATTCCGCTGCAGCCACAGGGAAGCAAAAAC
GAGGAGGCAGTGAAAGCCAAGCCTGATACTGAGAAGAGTGGTGCAGTTTCTGAACCAGCT
TTGCTTACTGCAGCTCAGAAGGAACGCTTGGAAAGCCTTGTTAATTTCAGCACAGTGATG
GCATTTATAAAAGGTACACCTGAGGAGCCCAAGTGTGGATTCAGTGGAAAACTAGTGCAT
ATTCTTAAGCAAGAGAAGATCCCTTTCTCAAGTTTTGACATTCTTACGGATGATGAGGTT
AGGCAGGGTCTAAAGCTTCTCTCAAACTGGCCTAGTTACCCTCAACTGTACATAAACGGT
GAACTGGTTGGCGGATCAGACATTGTTATGGAGATGCATAAGAGTGGGGAGCTTAAGAAG
GTTCTATCTGAGAAAGGGATCGTTGCGAAAGAAAGTCTAGAAGACCGCCTGAAGGCCCTG
ATTTCCTCTGCCCCAGTGATGCTCTTCATGAAGGGCACCCCAGATGCCCCCCGCTGCGGC
TTCAGTTCGAAGGTTGTGAATGCACTGAAGCAAGCAGGAGTCAGCTTCGGAGCGTTCGAC
ATCCTATCCGACGAGGAGGTTAGGCAAGGCTTGAAGACGTACTCCAACTGGCCCACGTTC
CCTCAGCTGTACTACAAATCAGAACTGATTGGAGGCTGTGACATCGTTCTTGAGCTGGAG
AAGAGTGGAGAGCTGAAGTCCACGCTTTCGGAGTGA

Protein

492 aa

>Os10t0500700-01 Glutaredoxin, Drought stress response
MAAVREVGSKAELEAAAGGARAAAVHFWAAWCEASKQMDEVFAHLAVDFSHAVFLRVEAE
EQPEISEAYGVTAVPYFVFLKEGKTVDTLEGANPASLANKVAKLAGPASVAESAVPASLG
VAAGPAVLEKVQEMAQQNGASATSSAEDALNKRLEQLVNSHPVFLFMKGTPEQPRCGFSR
KVVDVLKQEGVEFGSFDILTDNDVREGMKKFSNWPTFPQLYCKGELLGGCDIVIAMHESG
ELKDVFKEHNIPLQPQGSKNEEAVKAKPDTEKSGAVSEPALLTAAQKERLESLVNFSTVM
AFIKGTPEEPKCGFSGKLVHILKQEKIPFSSFDILTDDEVRQGLKLLSNWPSYPQLYING
ELVGGSDIVMEMHKSGELKKVLSEKGIVAKESLEDRLKALISSAPVMLFMKGTPDAPRCG
FSSKVVNALKQAGVSFGAFDILSDEEVRQGLKTYSNWPTFPQLYYKSELIGGCDIVLELE
KSGELKSTLSE*

5'UTR

chr10:19096820..19096959 (+ strand) : 140 bp

CDS

chr10:19096960..19097127 (+ strand) : 168 bp

chr10:19098304..19098378 (+ strand) : 75 bp

chr10:19099040..19100272 (+ strand) : 1233 bp

3'UTR

chr10:19100273..19100471 (+ strand) : 199 bp

FASTA

>Os10t0500700-01 class=Sequence position=chr10:19096820..19100471 (+ strand)
AAAAGGAAAG CAGAGGAAAA CCCCAAGCCG CAAGCCCCCC CGCCGCGAGT CGTCTTCTCA TCTCTCCTCC GCCGCCGCCG
CCTGCTGCTG CATCTCTCGT CGTCGCCGGT GAGGGAAGGG AGGGGAGGGG GGAGGGCGTG ATGGCGGCGG TGAGGGAGGT
GGGGTCGAAG GCGGAGCTGG AGGCGGCGGC GGGAGGGGCG CGGGCCGCCG CGGTGCACTT CTGGGCGGCG TGGTGCGAGG
CGTCCAAGCA GATGGACGAG GTCTTCGCGC ACCTCGCCGT CGACTTCTCC CACGCCGTCT TCCTCCGGGT ACGTGCGTGC
GCTCGTGCCA CTGCTGGTGT CCTCCCCGAT CGCGGTAGAT TTGAGCTGTT TAGTTCGCTT AGGGTTATGG TGTGGTAAGG
ATTTTGGTGG AAGGTTACAG TGACTTGCTT GCTGGTGGCT TCACATACTG TATTTCCTAC CATTTGTTTT AGTAGATTCA
TATGAGATGT TTTTCGGATG ATGAATTGTG AATCTTGTTT CAAGAATCAT GAGTAGATTT GGAATTAGTT TGCTTTTATA
TATCTGGGAA GTAGGTATAT GTTTTTGAGA GGTTGATACT AACCTGGCTG CCTGGAGTTC TGCCATAATA TAGAGCCCAT
AGTATATAAA TTATTGATAG TGATTATTTC TTCGATGTTC TGTGTAGGAT AAATGCTATT GAAGCTGCTC TACTTCTGTG
TTTGATTTGT AACTGTGGTG TTGTTTCTTT TACTTCATAG TATTGTGTAG GGATGTATCA ACTATCAAGT ACAATTCTTC
TTCTTTGATT GCCGATCCAA CTTGTTTATC CAGTTTGACT TACTGCAACT AACTAAAGAG CCAGTTTGAC TTACTGCAAC
TAACTAAAGA GGTAGTTGTG TAACATCCTT AAGCGCTGAC CATTTTCCTG CTTAGCGTAC AATTCTTTGA TTGCCCATCC
AACTTGTTTA TCCAGTTTGA CTTACTGGTT GAATGCAACT CCTGAAGAGG TAGTTGTGTA ACATCCTTAA GCGCTGATCA
TTTTCCTGCT TAGCACCGAT TCACTGTTTA TTCCACCTTG GGTTGTAGCT TACTGCATGT CTGACTAGTT GCTATTGTGC
TAGGAACCAT ACTCTTAGCG CTAGAATATG TCCTGCAACC TTTTGAGTTC TCAGTGGACT CTGAAATCTG TCAAGACTCA
AGAGTATGAG ACAAAATATA AATATTTCCA GTCCCTTACA TAATTATGAT TCGTTTTGCT ACTGGATTAT TCTGTAGTTT
CATTGAGTGA TACCATCAAA CTGAGTGTTA TATAATAAAT ACTGTTATAA TTCAGTAGCT CTTCTTTGTG ACTATTTTTC
TTTGGGCATT ACTTATATTC CTATTAGTCT CTCTAGTAAT TGTTAATCAC TGTATTATAT TGTAGAATTT GACTTCTATA
TCATTTGCTT GTTTGTTTTC TCATACACTA GTAACTTTTG TCAGGTTGAA GCTGAGGAAC AACCCGAAAT TTCAGAGGCA
TATGGAGTTA CAGCAGTGCC ATATTTTGTT TTCTTGAAGG TATTCGCAAC TGCCTTTATA TAATTTGTTC TGACACGAAC
CATTTCACAT AGTTATATAT TTTTGCATAA TAACTTCTGG TAGGATCATG ATACTCTTCC TTACTAACTT GATGCGGATG
AGTTCTAGCC TTGTATAATG CTAGTATGGC TATAATGCTG AATAAGTAGC TTGTATTCTT CCAACAAGAT GAGAGGTGCA
ATAATTTTTT TATTCCACAA AATAGTGATC AGATTTGCTT GCTCATATAC CCTGAAGTAA TGAGTTTGGA TTGTCTCCAC
TGACATTAGC TGCCTACAGT GAAGTTACCA TTTTTTAGAG GTGCAGTAAA GATTCTACCT TGTTGTGTAA TTTAGTGCAC
CATAACTGTC TGCACTAAAG ACTCCTTATG AATGTATCTT ATGACATCTG ATGAGGTGTG TTGTCTGATG GTGTAACACA
CAGTCTCTCT CAATTCATGG ACTTACAATC AGTATGAGCT GTGAATTGTG CTCTTGAACC AATGCACCTG ATCATATGAT
TATTACTATT AAAGCTTGCA TGCATAGGTC CTTTAGTATA TTGCTGAATA TTTGTTAGCA AATTATTTGA AATATCAGTA
TGATGCTTTT TACTTAAAGA GGTTGTCATC TTTGTGTCTT TGTTTTTTTG GGGTTTGCAG GAAGGTAAAA CTGTTGATAC
TCTGGAGGGT GCAAATCCAG CCAGCTTGGC CAATAAGGTT GCAAAGTTAG CTGGGCCTGC CAGCGTTGCT GAGTCTGCTG
TGCCTGCTAG CCTGGGTGTG GCTGCTGGGC CTGCTGTACT TGAAAAGGTT CAAGAGATGG CACAGCAAAA TGGAGCTTCT
GCCACTAGTA GTGCAGAAGA TGCATTGAAC AAGAGATTGG AGCAGCTTGT CAATTCCCAT CCCGTCTTCT TATTTATGAA
GGGAACCCCT GAGCAACCAA GGTGTGGTTT CAGTCGAAAA GTAGTTGACG TTTTGAAGCA GGAAGGAGTT GAATTTGGGA
GCTTTGACAT CCTAACAGAT AACGATGTAC GTGAAGGAAT GAAAAAGTTC TCAAACTGGC CGACTTTTCC TCAGCTCTAC
TGCAAAGGTG AGCTGCTTGG TGGATGTGAT ATTGTGATTG CTATGCATGA AAGCGGTGAA CTGAAGGATG TTTTTAAGGA
GCACAACATT CCGCTGCAGC CACAGGGAAG CAAAAACGAG GAGGCAGTGA AAGCCAAGCC TGATACTGAG AAGAGTGGTG
CAGTTTCTGA ACCAGCTTTG CTTACTGCAG CTCAGAAGGA ACGCTTGGAA AGCCTTGTTA ATTTCAGCAC AGTGATGGCA
TTTATAAAAG GTACACCTGA GGAGCCCAAG TGTGGATTCA GTGGAAAACT AGTGCATATT CTTAAGCAAG AGAAGATCCC
TTTCTCAAGT TTTGACATTC TTACGGATGA TGAGGTTAGG CAGGGTCTAA AGCTTCTCTC AAACTGGCCT AGTTACCCTC
AACTGTACAT AAACGGTGAA CTGGTTGGCG GATCAGACAT TGTTATGGAG ATGCATAAGA GTGGGGAGCT TAAGAAGGTT
CTATCTGAGA AAGGGATCGT TGCGAAAGAA AGTCTAGAAG ACCGCCTGAA GGCCCTGATT TCCTCTGCCC CAGTGATGCT
CTTCATGAAG GGCACCCCAG ATGCCCCCCG CTGCGGCTTC AGTTCGAAGG TTGTGAATGC ACTGAAGCAA GCAGGAGTCA
GCTTCGGAGC GTTCGACATC CTATCCGACG AGGAGGTTAG GCAAGGCTTG AAGACGTACT CCAACTGGCC CACGTTCCCT
CAGCTGTACT ACAAATCAGA ACTGATTGGA GGCTGTGACA TCGTTCTTGA GCTGGAGAAG AGTGGAGAGC TGAAGTCCAC
GCTTTCGGAG TGAGGAAAAT TTACCGTCGT ATCCGCATCT TCCTCTTCCT GGTGTTTCTA CCATCCGTCG ACCATCGAGT
TTGCTCTATT GATGGCATTT TCTTGTATTC ATAGATCCGT ATTTCAAACT TAGATATATG CCTGTGCCAC ATCGCTTTTA
ACTGTGACAT CTGCAGAAGA ATAACTAAGA CGACCTGTTC AGTACGGCTA AT

Locus: Os10g0500700

Loading...

Locus: Os10g0500700

Loading...