Os10t0500700-02

Locus

Os10g0500700

Description

Thioredoxin fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GRX22

CGSNL Gene Name

GLUTAREDOXIN 22

Oryzabase Gene Symbol Synonym(s)

OsGRX22, OsGRXS17, GRXS17

Oryzabase Gene Name Synonym(s)

glutaredoxin 22, Glutaredoxin S17

Transcript Evidence

AK105626 (DDBJ, Best hit)

Protein Evidence

Q0IWL9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell redox homeostasis (GO:0045454)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)

Functional domain (InterPro)

Glutaredoxin (IPR002109)

Monothiol glutaredoxin-related (IPR004480)

Thioredoxin-like fold (IPR012336)

Thioredoxin domain (IPR013766)

Full-length cDNA

001-200-C12 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0500700-02)

RiceXPro (AK105626)

Others

Oryzabase (13583)

KEGG (Os10t0500700-02)

Transcript

1441 bp

>Os10t0500700-02 Thioredoxin fold domain containing protein.
GCGAGTCGTCTTCTCATCTCTCCTCCGCCGCCGCCGCCTGCTGCTGCATCTCTCGTCGTC
GCCGGTGAGGGAAGGGAGGGGAGGGGGGAGGGCGTGATGGCGGCGGTGAGGGAGGTGGGG
TCGAAGGCGGAGCTGGAGGCGGCGGCGGGAGGGGCGCGGGCCGCCGCGGTGCACTTCTGG
GCGGCGTGGTGCGAGGCGTCCAAGCAGATGGACGAGGTCTTCGCGCACCTCGCCGTCGAC
TTCTCCCACGCCGTCTTCCTCCGGGTTGAAGCTGAGGAACAACCCGAAATTTCAGAGGCA
TATGGAGTTACAGCAGTGCCATATTTTGTTTTCTTGAAGGAAGGTAAAACTGTTGATACT
CTGGAGGGTGCAAATCCAGCCAGCTTGGCCAATAAGGTTGCAAAGTTAGCTGGGCCTGCC
AGCGTTGCTGAGTCTGCTGTGCCTGCTAGCCTGGGTGTGGCTGCTGGGCCTGCTGTACTT
GAAAAGGTTCAAGAGATGGCACAGCAAAATGGAGCTTCTGCCACTAGTAGTGCAGAAGAT
GCATTGAACAAGAGATTGGAGCAGCTTGTCAATTCCCATCCCGTCTTCTTATTTATGAAG
GGAACCCCTGAGCAACCAAGGTGTGGTTTCAGTCGAAAAGTAGTTGACGTTTTGAAGCAG
GAAGGAGTTGAATTTGGGAGCTTTGACATCCTAACAGATAACGATGTACGTGAAGGAATG
AAAAAGTTCTCAAACTGGCCGACTTTTCCTCAGCTCTACTGCAAAGGTGAGCTGCTTGGT
GGATGTGATATTGTGATTGCTATGCATGAAAGCGGTGAACTGAAGGATGTTTTTAAGGAG
CACAACATTCCGCTGCAGCCACAGGGAAGCAAAAACGAGGAGGCAGTGAAAGCCAAGCCT
GATACTGAGAAGAGTGGTGCAGTTTCTGAACCAGCTTTGCTTACTGCAGCTCAGAAGGAA
CGCTTGGAAAGCCTTGTTAATTTCAGCACAGTGATGGCATTTATAAAAGGTACACCTGAG
GAGCCCAAGTGTGGATTCAGTGGAAAACTAGTGCATATTCTTAAGCAAGAGAAGATCCCT
TTCTCAAGTTTTGACATTCTTACGGATGATGAGGTTAGGCAGGGTCTAAAGCTTCTCTCA
AACTGGCCTAGTTACCCTCAACTGTACATAAACGGTGAACTGATTGGAGGCTGTGACATC
GTTCTTGAGCTGGAGAAGAGTGGAGAGCTGAAGTCCACGCTTTCGGAGTGAGGAAAATTT
ACCGTCGTATCCGCATCTTCCTCTTCCTGGTGTTTCTACCATCCGTCGACCATCGAGTTT
GCTCTATTGATGGCATTTTCTTGTATTCATAGATCCGTATTTCAAACTTAGATATATGCC
TGTGCCACATCGCTTTTAACTGTGACATCTGCAGAAGAATAACTAAGACGACCTGTTCAG
T

CDS

1155 bp

>Os10t0500700-02 Thioredoxin fold domain containing protein.
ATGGCGGCGGTGAGGGAGGTGGGGTCGAAGGCGGAGCTGGAGGCGGCGGCGGGAGGGGCG
CGGGCCGCCGCGGTGCACTTCTGGGCGGCGTGGTGCGAGGCGTCCAAGCAGATGGACGAG
GTCTTCGCGCACCTCGCCGTCGACTTCTCCCACGCCGTCTTCCTCCGGGTTGAAGCTGAG
GAACAACCCGAAATTTCAGAGGCATATGGAGTTACAGCAGTGCCATATTTTGTTTTCTTG
AAGGAAGGTAAAACTGTTGATACTCTGGAGGGTGCAAATCCAGCCAGCTTGGCCAATAAG
GTTGCAAAGTTAGCTGGGCCTGCCAGCGTTGCTGAGTCTGCTGTGCCTGCTAGCCTGGGT
GTGGCTGCTGGGCCTGCTGTACTTGAAAAGGTTCAAGAGATGGCACAGCAAAATGGAGCT
TCTGCCACTAGTAGTGCAGAAGATGCATTGAACAAGAGATTGGAGCAGCTTGTCAATTCC
CATCCCGTCTTCTTATTTATGAAGGGAACCCCTGAGCAACCAAGGTGTGGTTTCAGTCGA
AAAGTAGTTGACGTTTTGAAGCAGGAAGGAGTTGAATTTGGGAGCTTTGACATCCTAACA
GATAACGATGTACGTGAAGGAATGAAAAAGTTCTCAAACTGGCCGACTTTTCCTCAGCTC
TACTGCAAAGGTGAGCTGCTTGGTGGATGTGATATTGTGATTGCTATGCATGAAAGCGGT
GAACTGAAGGATGTTTTTAAGGAGCACAACATTCCGCTGCAGCCACAGGGAAGCAAAAAC
GAGGAGGCAGTGAAAGCCAAGCCTGATACTGAGAAGAGTGGTGCAGTTTCTGAACCAGCT
TTGCTTACTGCAGCTCAGAAGGAACGCTTGGAAAGCCTTGTTAATTTCAGCACAGTGATG
GCATTTATAAAAGGTACACCTGAGGAGCCCAAGTGTGGATTCAGTGGAAAACTAGTGCAT
ATTCTTAAGCAAGAGAAGATCCCTTTCTCAAGTTTTGACATTCTTACGGATGATGAGGTT
AGGCAGGGTCTAAAGCTTCTCTCAAACTGGCCTAGTTACCCTCAACTGTACATAAACGGT
GAACTGATTGGAGGCTGTGACATCGTTCTTGAGCTGGAGAAGAGTGGAGAGCTGAAGTCC
ACGCTTTCGGAGTGA

Protein

385 aa

>Os10t0500700-02 Thioredoxin fold domain containing protein.
MAAVREVGSKAELEAAAGGARAAAVHFWAAWCEASKQMDEVFAHLAVDFSHAVFLRVEAE
EQPEISEAYGVTAVPYFVFLKEGKTVDTLEGANPASLANKVAKLAGPASVAESAVPASLG
VAAGPAVLEKVQEMAQQNGASATSSAEDALNKRLEQLVNSHPVFLFMKGTPEQPRCGFSR
KVVDVLKQEGVEFGSFDILTDNDVREGMKKFSNWPTFPQLYCKGELLGGCDIVIAMHESG
ELKDVFKEHNIPLQPQGSKNEEAVKAKPDTEKSGAVSEPALLTAAQKERLESLVNFSTVM
AFIKGTPEEPKCGFSGKLVHILKQEKIPFSSFDILTDDEVRQGLKLLSNWPSYPQLYING
ELIGGCDIVLELEKSGELKSTLSE*

5'UTR

chr10:19096864..19096959 (+ strand) : 96 bp

CDS

chr10:19096960..19097127 (+ strand) : 168 bp

chr10:19098304..19098378 (+ strand) : 75 bp

chr10:19099040..19099876 (+ strand) : 837 bp

chr10:19100198..19100272 (+ strand) : 75 bp

3'UTR

chr10:19100273..19100462 (+ strand) : 190 bp

FASTA

>Os10t0500700-02 class=Sequence position=chr10:19096864..19100462 (+ strand)
GCGAGTCGTC TTCTCATCTC TCCTCCGCCG CCGCCGCCTG CTGCTGCATC TCTCGTCGTC GCCGGTGAGG GAAGGGAGGG
GAGGGGGGAG GGCGTGATGG CGGCGGTGAG GGAGGTGGGG TCGAAGGCGG AGCTGGAGGC GGCGGCGGGA GGGGCGCGGG
CCGCCGCGGT GCACTTCTGG GCGGCGTGGT GCGAGGCGTC CAAGCAGATG GACGAGGTCT TCGCGCACCT CGCCGTCGAC
TTCTCCCACG CCGTCTTCCT CCGGGTACGT GCGTGCGCTC GTGCCACTGC TGGTGTCCTC CCCGATCGCG GTAGATTTGA
GCTGTTTAGT TCGCTTAGGG TTATGGTGTG GTAAGGATTT TGGTGGAAGG TTACAGTGAC TTGCTTGCTG GTGGCTTCAC
ATACTGTATT TCCTACCATT TGTTTTAGTA GATTCATATG AGATGTTTTT CGGATGATGA ATTGTGAATC TTGTTTCAAG
AATCATGAGT AGATTTGGAA TTAGTTTGCT TTTATATATC TGGGAAGTAG GTATATGTTT TTGAGAGGTT GATACTAACC
TGGCTGCCTG GAGTTCTGCC ATAATATAGA GCCCATAGTA TATAAATTAT TGATAGTGAT TATTTCTTCG ATGTTCTGTG
TAGGATAAAT GCTATTGAAG CTGCTCTACT TCTGTGTTTG ATTTGTAACT GTGGTGTTGT TTCTTTTACT TCATAGTATT
GTGTAGGGAT GTATCAACTA TCAAGTACAA TTCTTCTTCT TTGATTGCCG ATCCAACTTG TTTATCCAGT TTGACTTACT
GCAACTAACT AAAGAGCCAG TTTGACTTAC TGCAACTAAC TAAAGAGGTA GTTGTGTAAC ATCCTTAAGC GCTGACCATT
TTCCTGCTTA GCGTACAATT CTTTGATTGC CCATCCAACT TGTTTATCCA GTTTGACTTA CTGGTTGAAT GCAACTCCTG
AAGAGGTAGT TGTGTAACAT CCTTAAGCGC TGATCATTTT CCTGCTTAGC ACCGATTCAC TGTTTATTCC ACCTTGGGTT
GTAGCTTACT GCATGTCTGA CTAGTTGCTA TTGTGCTAGG AACCATACTC TTAGCGCTAG AATATGTCCT GCAACCTTTT
GAGTTCTCAG TGGACTCTGA AATCTGTCAA GACTCAAGAG TATGAGACAA AATATAAATA TTTCCAGTCC CTTACATAAT
TATGATTCGT TTTGCTACTG GATTATTCTG TAGTTTCATT GAGTGATACC ATCAAACTGA GTGTTATATA ATAAATACTG
TTATAATTCA GTAGCTCTTC TTTGTGACTA TTTTTCTTTG GGCATTACTT ATATTCCTAT TAGTCTCTCT AGTAATTGTT
AATCACTGTA TTATATTGTA GAATTTGACT TCTATATCAT TTGCTTGTTT GTTTTCTCAT ACACTAGTAA CTTTTGTCAG
GTTGAAGCTG AGGAACAACC CGAAATTTCA GAGGCATATG GAGTTACAGC AGTGCCATAT TTTGTTTTCT TGAAGGTATT
CGCAACTGCC TTTATATAAT TTGTTCTGAC ACGAACCATT TCACATAGTT ATATATTTTT GCATAATAAC TTCTGGTAGG
ATCATGATAC TCTTCCTTAC TAACTTGATG CGGATGAGTT CTAGCCTTGT ATAATGCTAG TATGGCTATA ATGCTGAATA
AGTAGCTTGT ATTCTTCCAA CAAGATGAGA GGTGCAATAA TTTTTTTATT CCACAAAATA GTGATCAGAT TTGCTTGCTC
ATATACCCTG AAGTAATGAG TTTGGATTGT CTCCACTGAC ATTAGCTGCC TACAGTGAAG TTACCATTTT TTAGAGGTGC
AGTAAAGATT CTACCTTGTT GTGTAATTTA GTGCACCATA ACTGTCTGCA CTAAAGACTC CTTATGAATG TATCTTATGA
CATCTGATGA GGTGTGTTGT CTGATGGTGT AACACACAGT CTCTCTCAAT TCATGGACTT ACAATCAGTA TGAGCTGTGA
ATTGTGCTCT TGAACCAATG CACCTGATCA TATGATTATT ACTATTAAAG CTTGCATGCA TAGGTCCTTT AGTATATTGC
TGAATATTTG TTAGCAAATT ATTTGAAATA TCAGTATGAT GCTTTTTACT TAAAGAGGTT GTCATCTTTG TGTCTTTGTT
TTTTTGGGGT TTGCAGGAAG GTAAAACTGT TGATACTCTG GAGGGTGCAA ATCCAGCCAG CTTGGCCAAT AAGGTTGCAA
AGTTAGCTGG GCCTGCCAGC GTTGCTGAGT CTGCTGTGCC TGCTAGCCTG GGTGTGGCTG CTGGGCCTGC TGTACTTGAA
AAGGTTCAAG AGATGGCACA GCAAAATGGA GCTTCTGCCA CTAGTAGTGC AGAAGATGCA TTGAACAAGA GATTGGAGCA
GCTTGTCAAT TCCCATCCCG TCTTCTTATT TATGAAGGGA ACCCCTGAGC AACCAAGGTG TGGTTTCAGT CGAAAAGTAG
TTGACGTTTT GAAGCAGGAA GGAGTTGAAT TTGGGAGCTT TGACATCCTA ACAGATAACG ATGTACGTGA AGGAATGAAA
AAGTTCTCAA ACTGGCCGAC TTTTCCTCAG CTCTACTGCA AAGGTGAGCT GCTTGGTGGA TGTGATATTG TGATTGCTAT
GCATGAAAGC GGTGAACTGA AGGATGTTTT TAAGGAGCAC AACATTCCGC TGCAGCCACA GGGAAGCAAA AACGAGGAGG
CAGTGAAAGC CAAGCCTGAT ACTGAGAAGA GTGGTGCAGT TTCTGAACCA GCTTTGCTTA CTGCAGCTCA GAAGGAACGC
TTGGAAAGCC TTGTTAATTT CAGCACAGTG ATGGCATTTA TAAAAGGTAC ACCTGAGGAG CCCAAGTGTG GATTCAGTGG
AAAACTAGTG CATATTCTTA AGCAAGAGAA GATCCCTTTC TCAAGTTTTG ACATTCTTAC GGATGATGAG GTTAGGCAGG
GTCTAAAGCT TCTCTCAAAC TGGCCTAGTT ACCCTCAACT GTACATAAAC GGTGAACTGG TTGGCGGATC AGACATTGTT
ATGGAGATGC ATAAGAGTGG GGAGCTTAAG AAGGTTCTAT CTGAGAAAGG GATCGTTGCG AAAGAAAGTC TAGAAGACCG
CCTGAAGGCC CTGATTTCCT CTGCCCCAGT GATGCTCTTC ATGAAGGGCA CCCCAGATGC CCCCCGCTGC GGCTTCAGTT
CGAAGGTTGT GAATGCACTG AAGCAAGCAG GAGTCAGCTT CGGAGCGTTC GACATCCTAT CCGACGAGGA GGTTAGGCAA
GGCTTGAAGA CGTACTCCAA CTGGCCCACG TTCCCTCAGC TGTACTACAA ATCAGAACTG ATTGGAGGCT GTGACATCGT
TCTTGAGCTG GAGAAGAGTG GAGAGCTGAA GTCCACGCTT TCGGAGTGAG GAAAATTTAC CGTCGTATCC GCATCTTCCT
CTTCCTGGTG TTTCTACCAT CCGTCGACCA TCGAGTTTGC TCTATTGATG GCATTTTCTT GTATTCATAG ATCCGTATTT
CAAACTTAGA TATATGCCTG TGCCACATCG CTTTTAACTG TGACATCTGC AGAAGAATAA CTAAGACGAC CTGTTCAGT

Locus: Os10g0500700

Loading...

Locus: Os10g0500700

Loading...