Os10t0504650-00

Locus

Os10g0504650

Description

Similar to nonspecific lipid-transfer protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.7, OsLtpII.7

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.7, lipid transfer protein 2.7, type 2 non-specific lipid transfer protein 7

Transcript Evidence

ab initio prediction

Protein Evidence

Q7G2C5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Expression Databases

TENOR (Os10t0504650-00)

Others

Oryzabase (13535)

KEGG (Os10t0504650-00)

Transcript

303 bp

>Os10t0504650-00 Similar to nonspecific lipid-transfer protein.
ATGGCCAAGTGGACGGCTGCGATGGAGATGCTTCTGCTGGTGGCGGTGGCGGCGGCAGCT
GTGGCGGTGGTGGTGGCGCAGGCGCCGCCGCCGCCACAGTGCGACCCCGGGCTGCTGTCG
CCATGCGCGGCCCCGATCTTCTTCGGGACGGCGCCGTCGGCGTCGTGCTGCTCTAGCCTG
AAAGCACAACAGGGGTGCTTCTGCCAGTACGCGAAAGACCCGACGTACGCGTCCTACATC
AACAGCACCAATGCACGCAAGATGATCGCCGCCTGCGGCATCCCCTTGCCCAACTGCGGC
TAG

CDS

303 bp

>Os10t0504650-00 Similar to nonspecific lipid-transfer protein.
ATGGCCAAGTGGACGGCTGCGATGGAGATGCTTCTGCTGGTGGCGGTGGCGGCGGCAGCT
GTGGCGGTGGTGGTGGCGCAGGCGCCGCCGCCGCCACAGTGCGACCCCGGGCTGCTGTCG
CCATGCGCGGCCCCGATCTTCTTCGGGACGGCGCCGTCGGCGTCGTGCTGCTCTAGCCTG
AAAGCACAACAGGGGTGCTTCTGCCAGTACGCGAAAGACCCGACGTACGCGTCCTACATC
AACAGCACCAATGCACGCAAGATGATCGCCGCCTGCGGCATCCCCTTGCCCAACTGCGGC
TAG

Protein

101 aa

>Os10t0504650-00 Similar to nonspecific lipid-transfer protein.
MAKWTAAMEMLLLVAVAAAAVAVVVAQAPPPPQCDPGLLSPCAAPIFFGTAPSASCCSSL
KAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPLPNCG*

CDS

chr10:19288018..19288320 (- strand) : 303 bp

FASTA

>Os10t0504650-00 class=Sequence position=chr10:19288018..19288320 (- strand)
ATGGCCAAGT GGACGGCTGC GATGGAGATG CTTCTGCTGG TGGCGGTGGC GGCGGCAGCT GTGGCGGTGG TGGTGGCGCA
GGCGCCGCCG CCGCCACAGT GCGACCCCGG GCTGCTGTCG CCATGCGCGG CCCCGATCTT CTTCGGGACG GCGCCGTCGG
CGTCGTGCTG CTCTAGCCTG AAAGCACAAC AGGGGTGCTT CTGCCAGTAC GCGAAAGACC CGACGTACGC GTCCTACATC
AACAGCACCA ATGCACGCAA GATGATCGCC GCCTGCGGCA TCCCCTTGCC CAACTGCGGC TAG

Locus: Os10g0504650

Loading...

Locus: Os10g0504650

Loading...