Os10t0504700-00

Locus

Os10g0504700

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.8, OsLtpII.8

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.8, lipid transfer protein 2.8, type 2 non-specific lipid transfer protein 8

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os10t0504700-00)

Others

Oryzabase (13536)

Transcript

303 bp

>Os10t0504700-00
ATGGCGAAGTGGGCGGCTGCAATGGAGATGCTTCTGCTGGTGGTGGTGGCGACGGTGGCG
GTGGCGGTGGTGGTGGCGCAATCGCCGCCGCCGCCGCAGTGTGACCCCGGGCTGCTGTCG
CCATGCGCGGCCCCGATCTTCTTCGGGACGGCGCCGTCGGCGTCGTGCTGCTCTAGCCTG
AAAGCACAACAGGGGTGCTTCTGCCAGTACGCGAAAGACCCAATGTACGCGTCCTACATC
AACAGCACCAACGCACGCAAGATGATCGCCGCCTGCGGCATCCCCTTGCCCAACTGCGGC
TAG

CDS

303 bp

>Os10t0504700-00
ATGGCGAAGTGGGCGGCTGCAATGGAGATGCTTCTGCTGGTGGTGGTGGCGACGGTGGCG
GTGGCGGTGGTGGTGGCGCAATCGCCGCCGCCGCCGCAGTGTGACCCCGGGCTGCTGTCG
CCATGCGCGGCCCCGATCTTCTTCGGGACGGCGCCGTCGGCGTCGTGCTGCTCTAGCCTG
AAAGCACAACAGGGGTGCTTCTGCCAGTACGCGAAAGACCCAATGTACGCGTCCTACATC
AACAGCACCAACGCACGCAAGATGATCGCCGCCTGCGGCATCCCCTTGCCCAACTGCGGC
TAG

Protein

101 aa

>Os10t0504700-00
MAKWAAAMEMLLLVVVATVAVAVVVAQSPPPPQCDPGLLSPCAAPIFFGTAPSASCCSSL
KAQQGCFCQYAKDPMYASYINSTNARKMIAACGIPLPNCG*

CDS

chr10:19299589..19299891 (- strand) : 303 bp

FASTA

>Os10t0504700-00 class=Sequence position=chr10:19299589..19299891 (- strand)
ATGGCGAAGT GGGCGGCTGC AATGGAGATG CTTCTGCTGG TGGTGGTGGC GACGGTGGCG GTGGCGGTGG TGGTGGCGCA
ATCGCCGCCG CCGCCGCAGT GTGACCCCGG GCTGCTGTCG CCATGCGCGG CCCCGATCTT CTTCGGGACG GCGCCGTCGG
CGTCGTGCTG CTCTAGCCTG AAAGCACAAC AGGGGTGCTT CTGCCAGTAC GCGAAAGACC CAATGTACGC GTCCTACATC
AACAGCACCA ACGCACGCAA GATGATCGCC GCCTGCGGCA TCCCCTTGCC CAACTGCGGC TAG

Locus: Os10g0504700

Loading...

Locus: Os10g0504700

Loading...