Os10t0504900-01

Locus

Os10g0504900

Description

Similar to Lipid transfer protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.9, OsLtpII.9, LTP2.9, LtpII.9

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.9, lipid transfer protein 2.9, type 2 non-specific lipid transfer protein 9

Transcript Evidence

AK063117 (DDBJ, Best hit)

Protein Evidence

A6N1A5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

001-111-E03 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0504900-01)

RiceXPro (AK063117)

Others

Oryzabase (13537)

KEGG (Os10t0504900-01)

Transcript

486 bp

>Os10t0504900-01 Similar to Lipid transfer protein.
ACACCACATCGATCACATTCGATCACATTCGGCTAGTAACCAAGCGGCGGTTCTTGCGCT
AGCTAGCTCGAGCAATGGCGAAGTGGGCGGCTGCGATGGAGATGCTTCTGCTGGTGGTGT
GTGACCCCGGGCTGCTGTCGCCATGCGCGGCCCCGATCTTCTTCGGGACGGCGCCGTCGG
CGTCGTGCTGCTCTAGCCTGAAAGCACAGCAGGGGTGCTTCTGCCAGTACGCGAAAGACC
CGACGTACGCGTCCTACATCAACAGCACCAACGCACGCAAGATGATCGCCGCCTGCGGCA
TCCCCTTTCCCAACTGCAGCTAGGCTCCGTCGCCGCCGTTCACCGGTGCGGGCCATGATG
TGTGGCAACATATATAAATATATGGTGTACTGCGTGCTTGAATAAAATAAAGGACAATGT
GTGGAAACATATATAAATATATGGTGTACTGTGTATTTGAATAATATAAAGGATGTGTGT
TTGAAT

CDS

249 bp

>Os10t0504900-01 Similar to Lipid transfer protein.
ATGGCGAAGTGGGCGGCTGCGATGGAGATGCTTCTGCTGGTGGTGTGTGACCCCGGGCTG
CTGTCGCCATGCGCGGCCCCGATCTTCTTCGGGACGGCGCCGTCGGCGTCGTGCTGCTCT
AGCCTGAAAGCACAGCAGGGGTGCTTCTGCCAGTACGCGAAAGACCCGACGTACGCGTCC
TACATCAACAGCACCAACGCACGCAAGATGATCGCCGCCTGCGGCATCCCCTTTCCCAAC
TGCAGCTAG

Protein

83 aa

>Os10t0504900-01 Similar to Lipid transfer protein.
MAKWAAAMEMLLLVVCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQGCFCQYAKDPTYAS
YINSTNARKMIAACGIPFPNCS*

5'UTR

chr10:19303783..19303856 (+ strand) : 74 bp

CDS

chr10:19303857..19303901 (+ strand) : 45 bp

chr10:19303959..19304162 (+ strand) : 204 bp

3'UTR

chr10:19304163..19304325 (+ strand) : 163 bp

FASTA

>Os10t0504900-01 class=Sequence position=chr10:19303783..19304325 (+ strand)
ACACCACATC GATCACATTC GATCACATTC GGCTAGTAAC CAAGCGGCGG TTCTTGCGCT AGCTAGCTCG AGCAATGGCG
AAGTGGGCGG CTGCGATGGA GATGCTTCTG CTGGTGGTGG TTGCGGCGGC GGCGGTGGCG GTGGTGGTGG CACAAGCGCC
GCCGCCGCCG CCGCAGTGTG ACCCCGGGCT GCTGTCGCCA TGCGCGGCCC CGATCTTCTT CGGGACGGCG CCGTCGGCGT
CGTGCTGCTC TAGCCTGAAA GCACAGCAGG GGTGCTTCTG CCAGTACGCG AAAGACCCGA CGTACGCGTC CTACATCAAC
AGCACCAACG CACGCAAGAT GATCGCCGCC TGCGGCATCC CCTTTCCCAA CTGCAGCTAG GCTCCGTCGC CGCCGTTCAC
CGGTGCGGGC CATGATGTGT GGCAACATAT ATAAATATAT GGTGTACTGC GTGCTTGAAT AAAATAAAGG ACAATGTGTG
GAAACATATA TAAATATATG GTGTACTGTG TATTTGAATA ATATAAAGGA TGTGTGTTTG AAT

Locus: Os10g0504900

Loading...

Locus: Os10g0504900

Loading...