Os10t0505000-01

Locus

Os10g0505000

Description

Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.10, OsLtpII.10

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.10, lipid transfer protein 2.10, type 2 non-specific lipid transfer protein 10

Transcript Evidence

AK287776 (DDBJ, Best hit)

Protein Evidence

NP_001150064.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J065170J11 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0505000-01)

Others

Oryzabase (13538)

KEGG (Os10t0505000-01)

Transcript

654 bp

>Os10t0505000-01 Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.
AGTAATCAATTGACCAAGCGGTTCTTGCGCCTAGCTAGGTAGCTCGAgcaatggcgaagt
gggcggcggaagcgacggtgatggtggttctggcggtgacggtggcggtggcggtggtgg
cggcGCAGGCGCCACCGCCGGTGCAGTGCGATCCCGGGAAGCTGTCGGCGTGCGCGGTCC
CGATCTTCTTTGGGACTGCGCCGTCGAAGTCGTGCTGCTCCAACCTGCGCGCGCAGGAGA
AGGACGGGTGCTTCTGCCAGTACGCGAGAGACCCGATGTACGCGTCCTACATCAATAGCA
CCAACGCCCGCAATACCATCGCCGCCTGCGGCATCGCCTTTCCCAGCTGCTAGGCTAGCT
TCGATCGCCATGATGCATGGCGTATATTAAATATATGGTGTGTGCTTGAATAAAGGATGT
GAGTTTGAATCAGTAAGAACTATCGATCGATTAATGCACCCCCGTACGTACGTGTTTGAT
CGATCGATCAGCTGGTGTCTCCTGACTATTTAAGTTTGAGCTAATTTCCGATCTTGTGTG
GTACTATCAGTAGTAGTACTACTACACTACTACTAGTACTACTACTATAAACAAACATAT
ATTTTTTATGTATAAAAAAATATACACATATACAAATTTTGTATATGATGTGtg

CDS

303 bp

>Os10t0505000-01 Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.
atggcgaagtgggcggcggaagcgacggtgatggtggttctggcggtgacggtggcggtg
gcggtggtggcggcGCAGGCGCCACCGCCGGTGCAGTGCGATCCCGGGAAGCTGTCGGCG
TGCGCGGTCCCGATCTTCTTTGGGACTGCGCCGTCGAAGTCGTGCTGCTCCAACCTGCGC
GCGCAGGAGAAGGACGGGTGCTTCTGCCAGTACGCGAGAGACCCGATGTACGCGTCCTAC
ATCAATAGCACCAACGCCCGCAATACCATCGCCGCCTGCGGCATCGCCTTTCCCAGCTGC
TAG

Protein

101 aa

>Os10t0505000-01 Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.
MAKWAAEATVMVVLAVTVAVAVVAAQAPPPVQCDPGKLSACAVPIFFGTAPSKSCCSNLR
AQEKDGCFCQYARDPMYASYINSTNARNTIAACGIAFPSC*

5'UTR

chr10:19308019..19308068 (- strand) : 50 bp

CDS

chr10:19307716..19308018 (- strand) : 303 bp

3'UTR

chr10:19307415..19307715 (- strand) : 301 bp

FASTA

>Os10t0505000-01 class=Sequence position=chr10:19307415..19308068 (- strand)
AGTAATCAAT TGACCAAGCG GTTCTTGCGC CTAGCTAGGT AGCTCGAgca atggcgaagt gggcggcgga agcgacggtg
atggtggttc tggcggtgac ggtggcggtg gcggtggtgg cggcGCAGGC GCCACCGCCG GTGCAGTGCG ATCCCGGGAA
GCTGTCGGCG TGCGCGGTCC CGATCTTCTT TGGGACTGCG CCGTCGAAGT CGTGCTGCTC CAACCTGCGC GCGCAGGAGA
AGGACGGGTG CTTCTGCCAG TACGCGAGAG ACCCGATGTA CGCGTCCTAC ATCAATAGCA CCAACGCCCG CAATACCATC
GCCGCCTGCG GCATCGCCTT TCCCAGCTGC TAGGCTAGCT TCGATCGCCA TGATGCATGG CGTATATTAA ATATATGGTG
TGTGCTTGAA TAAAGGATGT GAGTTTGAAT CAGTAAGAAC TATCGATCGA TTAATGCACC CCCGTACGTA CGTGTTTGAT
CGATCGATCA GCTGGTGTCT CCTGACTATT TAAGTTTGAG CTAATTTCCG ATCTTGTGTG GTACTATCAG TAGTAGTACT
ACTACACTAC TACTAGTACT ACTACTATAA ACAAACATAT ATTTTTTATG TATAAAAAAA TATACACATA TACAAATTTT
GTATATGATG TGtg

Locus: Os10g0505000

Loading...

Locus: Os10g0505000

Loading...