Os10t0505500-01

Locus

Os10g0505500

Description

Nonspecific lipid transfer protein, Cold tolerance

RAP-DB Gene Symbol Synonym(s)

OsLTPL159

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.11, OsLtpII.11, LTP2.11, LtpII.11, OsLTPL159, LTPL159

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.11, lipid transfer protein 2.11, type 2 non-specific lipid transfer protein 11

Transcript Evidence

AK062529

Protein Evidence

Q7G2B6

Literature

PMID: 31469486

Note

Manual Curation

September 3, 2019

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain superfamily (IPR036312)

Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain (IPR016140)

Non-specific lipid-transfer protein type 2 (IPR033872)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

001-104-E01 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0505500-01)

RiceXPro (AK062529)

Others

Oryzabase (13539)

KEGG (Os10t0505500-01)

Transcript

581 bp

>Os10t0505500-01 Nonspecific lipid transfer protein, Cold tolerance
ACATCGATAACATTCGATCACATTCGGCTAGTAACCAAGCAGTTCTTACGCTAGAGCTAG
CTCGAGCAATGGTGAAGTGGGCAGCTGTGATGGAGATGCTTCTGCTGACGGCAGCAGCGA
CGGCGGTAGCGGTGGTGGCGGCGCAGTGTGACCCTGAGCAGCTATCGGCGTGCGTGAGCC
CGATCTTCTACGGGACGGCGCCATCAGAGTCGTGCTGCTCCAACCTACGCGCACAGCAGA
AGGAGGGGTGCCTCTGCCAGTACGCGAAAGACCCGACGTACGCGTCCTACGTCAACAACA
CCAACGCACGCAAGACCATCGCCGCCTGCGGCATCCCCATTCCCAGCTGCTAGGCTCGAT
CTCCCGCCGCCGCCGGCCATGATGCGTACGTGGCATATATACGCGTGGTGTGTACGTGCG
CTTGAAGAAAAGGGCGTGAGTTTGAATTAATAATTATCCAGTACGCGATGTTTGATCGAT
CGATGATGTGCCTTTTTTTTTTGGTATTTGAAGTTTGAACTCTGAATTTCATCTTGTGTT
AATTGGAGTATGATAGCTGTGTGTACATTCGTTTTGGAGGT

CDS

285 bp

>Os10t0505500-01 Nonspecific lipid transfer protein, Cold tolerance
ATGGTGAAGTGGGCAGCTGTGATGGAGATGCTTCTGCTGACGGCAGCAGCGACGGCGGTA
GCGGTGGTGGCGGCGCAGTGTGACCCTGAGCAGCTATCGGCGTGCGTGAGCCCGATCTTC
TACGGGACGGCGCCATCAGAGTCGTGCTGCTCCAACCTACGCGCACAGCAGAAGGAGGGG
TGCCTCTGCCAGTACGCGAAAGACCCGACGTACGCGTCCTACGTCAACAACACCAACGCA
CGCAAGACCATCGCCGCCTGCGGCATCCCCATTCCCAGCTGCTAG

Protein

95 aa

>Os10t0505500-01 Nonspecific lipid transfer protein, Cold tolerance
MVKWAAVMEMLLLTAAATAVAVVAAQCDPEQLSACVSPIFYGTAPSESCCSNLRAQQKEG
CLCQYAKDPTYASYVNNTNARKTIAACGIPIPSC*

5'UTR

chr10:19330903..19330970 (- strand) : 68 bp

CDS

chr10:19330618..19330902 (- strand) : 285 bp

3'UTR

chr10:19330390..19330617 (- strand) : 228 bp

FASTA

>Os10t0505500-01 class=Sequence position=chr10:19330390..19330970 (- strand)
ACATCGATAA CATTCGATCA CATTCGGCTA GTAACCAAGC AGTTCTTACG CTAGAGCTAG CTCGAGCAAT GGTGAAGTGG
GCAGCTGTGA TGGAGATGCT TCTGCTGACG GCAGCAGCGA CGGCGGTAGC GGTGGTGGCG GCGCAGTGTG ACCCTGAGCA
GCTATCGGCG TGCGTGAGCC CGATCTTCTA CGGGACGGCG CCATCAGAGT CGTGCTGCTC CAACCTACGC GCACAGCAGA
AGGAGGGGTG CCTCTGCCAG TACGCGAAAG ACCCGACGTA CGCGTCCTAC GTCAACAACA CCAACGCACG CAAGACCATC
GCCGCCTGCG GCATCCCCAT TCCCAGCTGC TAGGCTCGAT CTCCCGCCGC CGCCGGCCAT GATGCGTACG TGGCATATAT
ACGCGTGGTG TGTACGTGCG CTTGAAGAAA AGGGCGTGAG TTTGAATTAA TAATTATCCA GTACGCGATG TTTGATCGAT
CGATGATGTG CCTTTTTTTT TTGGTATTTG AAGTTTGAAC TCTGAATTTC ATCTTGTGTT AATTGGAGTA TGATAGCTGT
GTGTACATTC GTTTTGGAGG T

Locus: Os10g0505500

Loading...

Locus: Os10g0505500

Loading...