Os10t0506800-01

Locus

Os10g0506800

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET39

Oryzabase Gene Name Synonym(s)

SET protein 39

Transcript Evidence

AK067969 (DDBJ, Best hit)

Protein Evidence

Q7G2A7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

SET domain (IPR001214)

Zinc finger, MYND-type (IPR002893)

Tetratricopeptide-like helical (IPR011990)

Tetratricopeptide repeat-containing (IPR013026)

Tetratricopeptide repeat (IPR019734)

Full-length cDNA

J013122F06 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0506800-01)

RiceXPro (AK067969)

Others

Oryzabase (13402)

KEGG (Os10t0506800-01)

Transcript

2713 bp

>Os10t0506800-01 SET domain containing protein.
GCTGCTGCCCACAGCCCACACACTCTCCCTCGCCCATGGAGCGGCTCAAGTCGGCGGTGC
CGGCGGAGCTCCGGCGAGCCGTCGGCGAGGGCACGGCGGCCGACCTCCCCTCCACCACCT
CCCGCTTGCTCGCCTTCCTCGAAGCtctccctctcttccgccagGTGATTGGTGAGCTGA
CCGACCCGGAGCTCGCGCTGTGCCGCAAGGACAAGGGGAGGGCGGCCGAGCTGAAGGGGA
AGGGGAATGCGTGCTTCTCCAAGAGAGAGTTCGAGCAAGCGCTTGGATTCTACTCGCAGG
CGTTACGGTACTTCCCGATTAGTCCTGATGGAACGGATGCAAGCTTGATAGCCACATTAT
ATGTCAACCGTGCCTCTACCATGCATAAATTGGGCCTTTTGGAAGAGTGTCTGCGAGATT
GCGACAGGGCCATTTCTGTTTCACCTAATTATGCTAAGGCATGGTACAGAAGGGGGATGG
TAAATGCATCTTTTAGGAACTATTCATCTTCCATACATGATTTGGAGGTTGCTTTGAGCA
TGGAAGTAACCTCTTCTGGAAAGAGTAACATAGAACAAGAGTTGAAGTTGATTTTACAAA
AGCATCAAAATGTGAATGAAGTTGGGACAGCAAGCAGCAATTGCATCAATGCAGATATGC
CACATACAGAGCAACAGCCTAAGGTTATTCTAGAATGTACCTCTACACCCAACAAAGGTA
GAGGAATGTCGTCTCCAAATGATATTTCTCCAGCCTCACTGATTCATGCTGAGGATCCTC
TTGCTGTGATTATCATGAAATCTTGCCGGGATACTCACTGCCACTATTGCTTTAGTGAAG
CTCCAGCAGATGTCGTAGTCTGCCCTTCATGTACAATACCCATTTACTGTTCAAACAGGT
GCCAGGAGAAGGCTATAGGACAAATGTCTTGTAATCAAAATACTCATCTAGAATCTAACA
ATAATGTGGTGGATATTGCAAAATTGAGTGTAACTTCTACAAAGAGCAAGACTCCAGACT
CTAAACAAATTGCTGAACATAGGCATGAATGTGGAGGTGCCTGTTGGGCAGCTGTTTTGC
CAGCTGATATAGTTTTAGCTGGGCGGATAATGGCACAGTACATAGAGAAACAATTGCTGG
TCGGAAAGAGATCTACCATCTCTGGTCCAAATCTGGATCTCGTTCACCACTATGATCAAG
ATTCTTCTGCTAGCAAATTTGAGTCACATATATATGCAACTGTCCTGTTCTTATGCCTCC
AGAGCTATTATAAATCAGGTGTCTCGTGGGCAGAGGATTCTTTATCACAGTTGGTTCTTT
TGATATGTCAAATTAAAGTCAACTCAATTGCAATTGTTCATATGAAATCCATGGATGGAG
TCAAGGCGCTGACAAAGGGGTTTTCTGGATTTAGTGGTGATGTTATGTGTAGTGTGGAAC
AGGTCAGGGTTGCTCAAGCTATTTACATGTCTGGTAGCTTTTTCAACCACTCGTGCCGGC
CCAACATACATGCATATTTTCATTCGCGCACTCTCATTCTAAGGTCTACAGAATATATAA
AAGCAGGTAGCCCAATCGAGCTGTCATACGGCCCACAGGTTGGTGAGATGGATCTTCCAG
AGAGACAAAAGTCACTTCGGGAGAATTACTACTTCAGTTGTGGGTGTTCAAGTTGTTCAG
TACTAAGTCTATCAGACCTTGTCATGAATTCATTTTGCTGTCCGCAAAGTAATTGCCTTG
GTGCTGTATCAGAATTAATTCATCATAGACACAAAGAGAATTTTGTGCATGTTTCCATAG
GAGAATCTCATGTCTGTACATTATCATTACCTGATGTATCTAAGTTTGATGAGGATATAG
TGAAGGTTGGAAAACTATTTTTCAAGAGTGATACCATGTTCAACATAGATCCTGGATTCT
GTATGAGTTGCAGATCCCAACTTGACTTGTCTTCTGCTGTTGCTATGTCAGATAGAGCAA
CATCAAAGATAAACAGATTGAAGGAGCTTCCATCTCTAGACAATGTCCCTGAAGTCCTCA
TTGCAGAAGCACTACAATCCTTAGAACGCATTGAGAAGTTAAGGCACCCATATAGCAAGA
CTCTTGCTCAGTCACACGACACAATTGCTGAGGCCTTTGCTAAGGTAGGAGATCAAGAAC
AAGCAAGAAAACACTGTGAAGCATCCATCAAGATTCTTGAGAAGCTTTACCACCCCAGGC
ACATCATCATCGCGCACGAGTTGATCAAGCTCGTCTCCATCGAGCTTTCCATGGGAGATG
GCGCAAGCGCGGCTGCTGCATTCGCCCGGGCAGATGCGATATTCTCGCTGTATTATGGGC
CTGATGTAGAGAGGATTTTGCCCTACGTTGATGTGCTCAGAAGAACTGTCAGTGAACGGT
CTATTGATTCATGTTGACCATCTTACAGTATGTGTATCAGTACATGCTGTTGTATCAGCA
ATTAGTAGACAAATCTAGAAAAAGAGATCAGATTAGTTAGACCCATTACGTTACAGAAAT
CTAGAAAAAATAGAGCATATTAGTTAAACCCATCTACTACATTACAGTCTTGCCCCTGTG
TTTTATGAATTTTCTTCTGGGATTTTCTGAAACCTACATGATTTCTGAAATTTCATTAGC
ATTTGCAGTGTCAAAAGAGGATGGTACTAGAGTAATAATAAGATAGTAAAGCCTGGTAGG
GCTCTGTTTTTTG

CDS

2382 bp

>Os10t0506800-01 SET domain containing protein.
ATGGAGCGGCTCAAGTCGGCGGTGCCGGCGGAGCTCCGGCGAGCCGTCGGCGAGGGCACG
GCGGCCGACCTCCCCTCCACCACCTCCCGCTTGCTCGCCTTCCTCGAAGCtctccctctc
ttccgccagGTGATTGGTGAGCTGACCGACCCGGAGCTCGCGCTGTGCCGCAAGGACAAG
GGGAGGGCGGCCGAGCTGAAGGGGAAGGGGAATGCGTGCTTCTCCAAGAGAGAGTTCGAG
CAAGCGCTTGGATTCTACTCGCAGGCGTTACGGTACTTCCCGATTAGTCCTGATGGAACG
GATGCAAGCTTGATAGCCACATTATATGTCAACCGTGCCTCTACCATGCATAAATTGGGC
CTTTTGGAAGAGTGTCTGCGAGATTGCGACAGGGCCATTTCTGTTTCACCTAATTATGCT
AAGGCATGGTACAGAAGGGGGATGGTAAATGCATCTTTTAGGAACTATTCATCTTCCATA
CATGATTTGGAGGTTGCTTTGAGCATGGAAGTAACCTCTTCTGGAAAGAGTAACATAGAA
CAAGAGTTGAAGTTGATTTTACAAAAGCATCAAAATGTGAATGAAGTTGGGACAGCAAGC
AGCAATTGCATCAATGCAGATATGCCACATACAGAGCAACAGCCTAAGGTTATTCTAGAA
TGTACCTCTACACCCAACAAAGGTAGAGGAATGTCGTCTCCAAATGATATTTCTCCAGCC
TCACTGATTCATGCTGAGGATCCTCTTGCTGTGATTATCATGAAATCTTGCCGGGATACT
CACTGCCACTATTGCTTTAGTGAAGCTCCAGCAGATGTCGTAGTCTGCCCTTCATGTACA
ATACCCATTTACTGTTCAAACAGGTGCCAGGAGAAGGCTATAGGACAAATGTCTTGTAAT
CAAAATACTCATCTAGAATCTAACAATAATGTGGTGGATATTGCAAAATTGAGTGTAACT
TCTACAAAGAGCAAGACTCCAGACTCTAAACAAATTGCTGAACATAGGCATGAATGTGGA
GGTGCCTGTTGGGCAGCTGTTTTGCCAGCTGATATAGTTTTAGCTGGGCGGATAATGGCA
CAGTACATAGAGAAACAATTGCTGGTCGGAAAGAGATCTACCATCTCTGGTCCAAATCTG
GATCTCGTTCACCACTATGATCAAGATTCTTCTGCTAGCAAATTTGAGTCACATATATAT
GCAACTGTCCTGTTCTTATGCCTCCAGAGCTATTATAAATCAGGTGTCTCGTGGGCAGAG
GATTCTTTATCACAGTTGGTTCTTTTGATATGTCAAATTAAAGTCAACTCAATTGCAATT
GTTCATATGAAATCCATGGATGGAGTCAAGGCGCTGACAAAGGGGTTTTCTGGATTTAGT
GGTGATGTTATGTGTAGTGTGGAACAGGTCAGGGTTGCTCAAGCTATTTACATGTCTGGT
AGCTTTTTCAACCACTCGTGCCGGCCCAACATACATGCATATTTTCATTCGCGCACTCTC
ATTCTAAGGTCTACAGAATATATAAAAGCAGGTAGCCCAATCGAGCTGTCATACGGCCCA
CAGGTTGGTGAGATGGATCTTCCAGAGAGACAAAAGTCACTTCGGGAGAATTACTACTTC
AGTTGTGGGTGTTCAAGTTGTTCAGTACTAAGTCTATCAGACCTTGTCATGAATTCATTT
TGCTGTCCGCAAAGTAATTGCCTTGGTGCTGTATCAGAATTAATTCATCATAGACACAAA
GAGAATTTTGTGCATGTTTCCATAGGAGAATCTCATGTCTGTACATTATCATTACCTGAT
GTATCTAAGTTTGATGAGGATATAGTGAAGGTTGGAAAACTATTTTTCAAGAGTGATACC
ATGTTCAACATAGATCCTGGATTCTGTATGAGTTGCAGATCCCAACTTGACTTGTCTTCT
GCTGTTGCTATGTCAGATAGAGCAACATCAAAGATAAACAGATTGAAGGAGCTTCCATCT
CTAGACAATGTCCCTGAAGTCCTCATTGCAGAAGCACTACAATCCTTAGAACGCATTGAG
AAGTTAAGGCACCCATATAGCAAGACTCTTGCTCAGTCACACGACACAATTGCTGAGGCC
TTTGCTAAGGTAGGAGATCAAGAACAAGCAAGAAAACACTGTGAAGCATCCATCAAGATT
CTTGAGAAGCTTTACCACCCCAGGCACATCATCATCGCGCACGAGTTGATCAAGCTCGTC
TCCATCGAGCTTTCCATGGGAGATGGCGCAAGCGCGGCTGCTGCATTCGCCCGGGCAGAT
GCGATATTCTCGCTGTATTATGGGCCTGATGTAGAGAGGATTTTGCCCTACGTTGATGTG
CTCAGAAGAACTGTCAGTGAACGGTCTATTGATTCATGTTGA

Protein

794 aa

>Os10t0506800-01 SET domain containing protein.
MERLKSAVPAELRRAVGEGTAADLPSTTSRLLAFLEALPLFRQVIGELTDPELALCRKDK
GRAAELKGKGNACFSKREFEQALGFYSQALRYFPISPDGTDASLIATLYVNRASTMHKLG
LLEECLRDCDRAISVSPNYAKAWYRRGMVNASFRNYSSSIHDLEVALSMEVTSSGKSNIE
QELKLILQKHQNVNEVGTASSNCINADMPHTEQQPKVILECTSTPNKGRGMSSPNDISPA
SLIHAEDPLAVIIMKSCRDTHCHYCFSEAPADVVVCPSCTIPIYCSNRCQEKAIGQMSCN
QNTHLESNNNVVDIAKLSVTSTKSKTPDSKQIAEHRHECGGACWAAVLPADIVLAGRIMA
QYIEKQLLVGKRSTISGPNLDLVHHYDQDSSASKFESHIYATVLFLCLQSYYKSGVSWAE
DSLSQLVLLICQIKVNSIAIVHMKSMDGVKALTKGFSGFSGDVMCSVEQVRVAQAIYMSG
SFFNHSCRPNIHAYFHSRTLILRSTEYIKAGSPIELSYGPQVGEMDLPERQKSLRENYYF
SCGCSSCSVLSLSDLVMNSFCCPQSNCLGAVSELIHHRHKENFVHVSIGESHVCTLSLPD
VSKFDEDIVKVGKLFFKSDTMFNIDPGFCMSCRSQLDLSSAVAMSDRATSKINRLKELPS
LDNVPEVLIAEALQSLERIEKLRHPYSKTLAQSHDTIAEAFAKVGDQEQARKHCEASIKI
LEKLYHPRHIIIAHELIKLVSIELSMGDGASAAAAFARADAIFSLYYGPDVERILPYVDV
LRRTVSERSIDSC*

5'UTR

chr10:19379467..19379501 (- strand) : 35 bp

CDS

chr10:19379338..19379466 (- strand) : 129 bp

chr10:19379091..19379225 (- strand) : 135 bp

chr10:19378640..19378726 (- strand) : 87 bp

chr10:19378366..19378437 (- strand) : 72 bp

chr10:19378012..19378222 (- strand) : 211 bp

chr10:19377806..19377924 (- strand) : 119 bp

chr10:19377169..19377555 (- strand) : 387 bp

chr10:19376948..19377082 (- strand) : 135 bp

chr10:19376211..19376342 (- strand) : 132 bp

chr10:19375724..19375879 (- strand) : 156 bp

chr10:19375405..19375638 (- strand) : 234 bp

chr10:19375159..19375322 (- strand) : 164 bp

chr10:19374947..19375061 (- strand) : 115 bp

chr10:19374765..19374845 (- strand) : 81 bp

chr10:19374415..19374639 (- strand) : 225 bp

3'UTR

chr10:19374119..19374414 (- strand) : 296 bp

FASTA

>Os10t0506800-01 class=Sequence position=chr10:19374119..19379501 (- strand)
GCTGCTGCCC ACAGCCCACA CACTCTCCCT CGCCCATGGA GCGGCTCAAG TCGGCGGTGC CGGCGGAGCT CCGGCGAGCC
GTCGGCGAGG GCACGGCGGC CGACCTCCCC TCCACCACCT CCCGCTTGCT CGCCTTCCTC GAAGCtctcc ctctcttccg
ccaggtaacc acctcccgtc gctcggtgct ccgctgctcc tcctcttccc ccAGGCATGG GGGGGTGCGG CTAGATTTGA
TGGTATCGTT CGCGTGGCGT GTTGGTGTGA GGGCAGGTGA TTGGTGAGCT GACCGACCCG GAGCTCGCGC TGTGCCGCAA
GGACAAGGGG AGGGCGGCCG AGCTGAAGGG GAAGGGGAAT GCGTGCTTCT CCAAGAGAGA GTTCGAGCAA GCGCTTGGAT
TCTACTCGCA GGTTGATTTG TTGTGTTACT CGTTTATTTT TCTTCTTCTT CCTCTTGATT GCTTGGATTG TGTAGGTGAT
GAAGTGATGG GTTCTGATTC GATTGGTAAA AATGAGTGCA AGTTCAGAAG TCAGAAGTAA CTTTACTGTT CGAAGTTTGT
TGTTGTTCAC CTGTTCTGTT TTTTAAAGAG TGATGCGTTG ATATTGCAAA AGAAAATGAT CCTCACTCCT TTTCAGTACT
AGCATTTATG TGTGTGGACT GCAATCTATC TGTCTTTTTT TTTTTGGAAC AAATCGGCAC GGGACAATGC CCATTTTATT
GATATTCAAT CTATCAGTCT TGATGATAGC TAATTGTTTT TCTCTGTTGT TACAGGCGTT ACGGTACTTC CCGATTAGTC
CTGATGGAAC GGATGCAAGC TTGATAGCCA CATTATATGT CAACCGTGCC TCTACCATGC ATGTGAGTCT TTCATTTACC
TGTTTGCATT CTGGACATAT TGATGTAATG TTCTAGTTCT TGGTGGTGTT TCATGGTAAA CAGTGCATTG TGAATAGGTT
ATATTCAGCT TATTCCCTTT TATGTATCTA AGGATTTTTT TCCTGCCATC TGACCTCATT ACTGGATAGT GCATGCGTTC
TGATCATGTT TCTGAAGTTT ACAGAAATTG GGCCTTTTGG AAGAGTGTCT GCGAGATTGC GACAGGGCCA TTTCTGTTTC
ACCTAATTAT GCTAAGGTAG CAATACGGTT TGGGAACTTT GTTGAATGCA TCTTATATGC TTGGGTTGTT TGTTCTGTCT
CTATTTGCAG GATTTCACTC TAAAGAATGG AAACTAAGTT ACTCTGATGA TTTCACCTGT TTCTGTTTAT GGGTTTCAGG
CATGGTACAG AAGGGGGATG GTAAATGCAT CTTTTAGGAA CTATTCATCT TCCATACATG ATTTGGAGGT TGCTTTGAGC
ATGGAAGTAA CCTCTTCTGG AAAGAGTAAC ATAGAACAAG AGTTGAAGTT GATTTTACAA AAGCATCAAA ATGTGAATGA
AGTTGGGACA GCAAGCAGCA ATTGCATCAA TGCAGATATG CCACATACAG GTCGGTAATG ATGGTAGACA ACCAATTTAG
TATTCAAAAA GGTTAGGTAC GTATGTATAC TAAGTGAACG ATATGGCTAA ATGGCAGAGC AACAGCCTAA GGTTATTCTA
GAATGTACCT CTACACCCAA CAAAGGTAGA GGAATGTCGT CTCCAAATGA TATTTCTCCA GCCTCACTGA TTCATGCTGA
GGATCCTCTT GCTGTGGTAT GATCAAGAAT CATCTCCTCA ATTGTTTATG CCAAATGAGT TTTTTACGTG CCACCTAAAG
CTATACTGAG TTTCATTAGA TCTTTGTCCT AGTCAAATAT GAAATTTGAT AAGTTATAGT ATATTTTTAC TGTTTTATTA
TGCCAGGGCA GTAGCTTATC TCTATGAGCA TTGTTAAATA ATCAGTCAAC TATTGTAATC TTGAACTGAA GTTCTATATG
CCTCTTACTT GTACAGTTGT ATGCAGATTA TCATGAAATC TTGCCGGGAT ACTCACTGCC ACTATTGCTT TAGTGAAGCT
CCAGCAGATG TCGTAGTCTG CCCTTCATGT ACAATACCCA TTTACTGTTC AAACAGGTGC CAGGAGAAGG CTATAGGACA
AATGTCTTGT AATCAAAATA CTCATCTAGA ATCTAACAAT AATGTGGTGG ATATTGCAAA ATTGAGTGTA ACTTCTACAA
AGAGCAAGAC TCCAGACTCT AAACAAATTG CTGAACATAG GCATGAATGT GGAGGTGCCT GTTGGGCAGC TGTTTTGCCA
GCTGATATAG TTTTAGCTGG GCGGATAATG GCACAGTACA TAGAGAAACA ATTGCTGGTC GGAAAGAGAT CTACCATCTC
TGGTCCAAAT CTGGTATAAG AGAATTCATG TCTGCAAGCA CTCAAATGTT ATAGCATAAG TACTGTTACA TCAGGAACTA
ATGAACTAAA CTGTTGCAGG ATCTCGTTCA CCACTATGAT CAAGATTCTT CTGCTAGCAA ATTTGAGTCA CATATATATG
CAACTGTCCT GTTCTTATGC CTCCAGAGCT ATTATAAATC AGGTGTCTCG TGGGCAGAGG ATTCTTTATC ACAGGTATAT
GTGGCATTTG TCCTCAAGAG TTCCCTTTGT ATGTTTACAT TTTCAATTGC TTGTTTCATT ACAACTGTGG CTTGAGCTTG
ATGGCTGCTT TAGTCAGATT TTTTGGATTG TTCTGGATAT CAGATTTGAC ATTATTGTTT ATATTAGCTC AGtactccct
ccattccaaa ttgatctaca tatttcatag gtacactaag accaagaaaa gttaataact ctctcatact atatttactc
tagcatcaaa cttgatgcat gcactatccc cactatttct tagccaatag caaatcaaga tattgcatgt gggttatact
tgtgtgcatg gatgcatgca tcaatgtcca tttactccaa tgcacaaata acgaataggc ttaatgaatg aacacaaata
tgtagatcat ttaggaataa cctcaaaaat actatatgta gatcaatttg gaatggaggg agtaTTTCTT AAACTTTCAG
AATTCTGCCA TATACTTCTG CCCCCTAGGA TGTAGATTGT AGAGAACTGA TGGAACACTA TTTTCATATT TATTTATAAT
TACTGAAGAA GAAGCTAATT CTTGTAACTA TATCTGCAGT TGGTTCTTTT GATATGTCAA ATTAAAGTCA ACTCAATTGC
AATTGTTCAT ATGAAATCCA TGGATGGAGT CAAGGCGCTG ACAAAGGGGT TTTCTGGATT TAGTGGTGAT GTTATGTGTA
GTGTGGAACA GGTTTGTCTC CTCTTCTTAT CTTCTCTAGT AACATCACCC TATAAAAGCT GTTTGATATT TGTTGCCAAC
CATGGTGTTT CTATAGGAGT ACATTATTTA GGATAGTATG TTTCTGAATC ATGTTCAGGT AAATAGCAAT TTGGAAATTG
AAAAATTCTT TGTAGTAAAT TCAGCAAACA CATGACAACA TGTAGCTAAT CTTAAATTGC AATAAATAGC AATATCAGGC
ACAGTATTGT ATTACTCTTA CTTTGCTTTA GTTGAGTTAT CGCACCGCAG CTCATTTATT ATCTTGACCA TCTATAACCT
GTGTTTAGTT TTGCATTGTT AGGTCAGGGT TGCTCAAGCT ATTTACATGT CTGGTAGCTT TTTCAACCAC TCGTGCCGGC
CCAACATACA TGCATATTTT CATTCGCGCA CTCTCATTCT AAGGTCTACA GAATATATAA AAGCAGGTAG CCCAATCGAG
CTGTCATACG GCCCACAGGT ATCTTTCCTC CCTCCCTCTG TGATATACTG ACATCACGTG TAGCACATAT ATTTTCTGCA
TTGTCTATGT TTCTCGTTTT CAGGTTGGTG AGATGGATCT TCCAGAGAGA CAAAAGTCAC TTCGGGAGAA TTACTACTTC
AGTTGTGGGT GTTCAAGTTG TTCAGTACTA AGTCTATCAG ACCTTGTCAT GAATTCATTT TGCTGTCCGC AAAGTAATTG
CCTTGGTGCT GTATCAGAAT TAATTCATCA TAGACACAAA GAGAATTTTG TGCATGTTTC CATAGGAGAA TCTCATGTCT
GTACATTATC ATTACCTGTA AGATTATTCT CCTCACATAT TCTTTTCTCA AAAGTTTCTT GTTAGTAATT TGGTGGTATA
ACAGTTCTTT TTGCATCAGG ATGTATCTAA GTTTGATGAG GATATAGTGA AGGTTGGAAA ACTATTTTTC AAGAGTGATA
CCATGTTCAA CATAGATCCT GGATTCTGTA TGAGTTGCAG ATCCCAACTT GACTTGTCTT CTGCTGTTGC TATGTCAGAT
AGAGCAACAT CAAAGATAAA CAGGTATATC CTATATTCCT GTGAAATTGC ACATGAATTG CTGGATTTGA TTCCATTGTC
TGTGCTCTTT ACACATACAA ATTGACAATT ATGCTGACAG ATTGAAGGAG CTTCCATCTC TAGACAATGT CCCTGAAGTC
CTCATTGCAG AAGCACTACA ATCCTTAGAA CGCATTGAGA AGTTAAGGCA CCCATATAGC AAGACTCTTG CTCAGGTTTG
GTGCTTGTAC TAGTTTAATT ATGAGTTTTC TTGCACTTGA TGTAAAAAAG AATGATCTGA GTTCTTTCAT TTTTACTACC
ATATTGAAAT CTGTAGTCAC ACGACACAAT TGCTGAGGCC TTTGCTAAGG TAGGAGATCA AGAACAAGCA AGAAAACACT
GTGAAGCATC CATCAAGGTA ATAATCTTCT CCTTTTCCTC AAATCATCAC TCGGAGTCAC TCACTCGCCC TTCTAGGGAC
TATAGAAACA TCTGTTATTC ATTGTTCTGA CTTCTGAGTT ACCCTCTCCT GTGATGATGC AGATTCTTGA GAAGCTTTAC
CACCCCAGGC ACATCATCAT CGCGCACGAG TTGATCAAGC TCGTCTCCAT CGAGCTTTCC ATGGGAGATG GCGCAAGCGC
GGCTGCTGCA TTCGCCCGGG CAGATGCGAT ATTCTCGCTG TATTATGGGC CTGATGTAGA GAGGATTTTG CCCTACGTTG
ATGTGCTCAG AAGAACTGTC AGTGAACGGT CTATTGATTC ATGTTGACCA TCTTACAGTA TGTGTATCAG TACATGCTGT
TGTATCAGCA ATTAGTAGAC AAATCTAGAA AAAGAGATCA GATTAGTTAG ACCCATTACG TTACAGAAAT CTAGAAAAAA
TAGAGCATAT TAGTTAAACC CATCTACTAC ATTACAGTCT TGCCCCTGTG TTTTATGAAT TTTCTTCTGG GATTTTCTGA
AACCTACATG ATTTCTGAAA TTTCATTAGC ATTTGCAGTG TCAAAAGAGG ATGGTACTAG AGTAATAATA AGATAGTAAA
GCCTGGTAGG GCTCTGTTTT TTG

Locus: Os10g0506800

Loading...

Locus: Os10g0506800

Loading...