Os10t0510500-01

Locus

Os10g0510500

Description

Auxin responsive SAUR protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAUR56

CGSNL Gene Name

SMALL AUXIN-UP RNA 56

Oryzabase Gene Symbol Synonym(s)

OsSAUR56

Oryzabase Gene Name Synonym(s)

Small auxin-up RNA 56

Transcript Evidence

AK068270 (DDBJ, Best hit)

AK109491 (DDBJ, Best hit)

Protein Evidence

B6TBH1 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Auxin responsive SAUR protein (IPR003676)

Full-length cDNA

J013149I12 (Online Clone Ordering)

001-204-H09 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0510500-01)

RiceXPro (AK068270)

Others

Oryzabase (9181)

KEGG (Os10t0510500-01)

Transcript

1004 bp

>Os10t0510500-01 Auxin responsive SAUR protein family protein.
GGAGACCCCTCCTCCCCTCGGCAACGTAACACAAGAGAAGAAGAGATCGCCATGTCCAAC
GTGCCCACCTCCCTCCGCGACTCCTCCCTCACCGTCTTCCGCCTCGCCATCTCCAGCTCC
GACCCCTGGCCCTTCTCCCTTTAACCCCATCAAACGCTTCTTCCTCTTCCAAGAAGATCA
CAAGCTTCTTCGTGTTCTTGTTCTTCTTCGGATCACTCGGTTGGTTTCTTGGTTTCTTGG
TTTCTTGGATTGTTGCGAGATGCACGGGAAGCATCAGCATCAGCAGCAGCAGCAGCAGCA
GGGGGGGATGGTGGTGGTGGCGCCGAAGGGGTGCGTGACGGTGAGGGTGGGGGCGGAGGG
GGAGGAGCAGCGGCGGTTCGCCGTGCCGCTCGCCCACCTCAAGCACCCGCTCTTCGGGGC
GCTGCTCGAGGAGGCCGAGCGCGAGTACGGCTTCGCGCAGCGGGGCGCCATCGCCATCCC
CTGCCGCGTCGACCGCTTCGTCCACGTCGAGCACCTCATCGTCCAGGACCTCCACGGCGC
CGCCGCCTCCCACCTCCTCGACCTCGACTCCTCCTCCCACCACCACACCCAGATCCACCT
CCACCTCCCCCGCTTCGCCGGTTGCTTCCGCGCCTGATCCTTCCATCATCTCCATGGATG
CATCGCCATGGCGGTGGAGCGGAGCTCCCAGATTGCTCTTCTTCTTCTTCTTCAGGGTTG
GTTGGTCGATTAATTACTTAGTTTAGCTAGTTTTTTGGTTTCCTTTTGCTTCGTCCTCCG
ATCTCTCGGTTTGTTGGGGATGGATTTCGATTGGGTTTGTGGACGGGAGAATCGGAGGAC
GGATTCGATGCTGATGACGACGAAAAATTGAGATCGATCTCAAAAGTGTAAAGACAGAGT
AATTCTTCTTAGTAGCTTTATTCTAGTTTTATTTTTTTTATCTTTTTTCTTTGCTTGTAC
ATCCACTTCTTGAAACACATCAATAATACAGTATACTTTGATCG

CDS

378 bp

>Os10t0510500-01 Auxin responsive SAUR protein family protein.
ATGCACGGGAAGCATCAGCATCAGCAGCAGCAGCAGCAGCAGGGGGGGATGGTGGTGGTG
GCGCCGAAGGGGTGCGTGACGGTGAGGGTGGGGGCGGAGGGGGAGGAGCAGCGGCGGTTC
GCCGTGCCGCTCGCCCACCTCAAGCACCCGCTCTTCGGGGCGCTGCTCGAGGAGGCCGAG
CGCGAGTACGGCTTCGCGCAGCGGGGCGCCATCGCCATCCCCTGCCGCGTCGACCGCTTC
GTCCACGTCGAGCACCTCATCGTCCAGGACCTCCACGGCGCCGCCGCCTCCCACCTCCTC
GACCTCGACTCCTCCTCCCACCACCACACCCAGATCCACCTCCACCTCCCCCGCTTCGCC
GGTTGCTTCCGCGCCTGA

Protein

125 aa

>Os10t0510500-01 Auxin responsive SAUR protein family protein.
MHGKHQHQQQQQQQGGMVVVAPKGCVTVRVGAEGEEQRRFAVPLAHLKHPLFGALLEEAE
REYGFAQRGAIAIPCRVDRFVHVEHLIVQDLHGAAASHLLDLDSSSHHHTQIHLHLPRFA
GCFRA*

5'UTR

chr10:19632004..19632262 (- strand) : 259 bp

CDS

chr10:19631626..19632003 (- strand) : 378 bp

3'UTR

chr10:19631259..19631625 (- strand) : 367 bp

FASTA

>Os10t0510500-01 class=Sequence position=chr10:19631259..19632262 (- strand)
GGAGACCCCT CCTCCCCTCG GCAACGTAAC ACAAGAGAAG AAGAGATCGC CATGTCCAAC GTGCCCACCT CCCTCCGCGA
CTCCTCCCTC ACCGTCTTCC GCCTCGCCAT CTCCAGCTCC GACCCCTGGC CCTTCTCCCT TTAACCCCAT CAAACGCTTC
TTCCTCTTCC AAGAAGATCA CAAGCTTCTT CGTGTTCTTG TTCTTCTTCG GATCACTCGG TTGGTTTCTT GGTTTCTTGG
TTTCTTGGAT TGTTGCGAGA TGCACGGGAA GCATCAGCAT CAGCAGCAGC AGCAGCAGCA GGGGGGGATG GTGGTGGTGG
CGCCGAAGGG GTGCGTGACG GTGAGGGTGG GGGCGGAGGG GGAGGAGCAG CGGCGGTTCG CCGTGCCGCT CGCCCACCTC
AAGCACCCGC TCTTCGGGGC GCTGCTCGAG GAGGCCGAGC GCGAGTACGG CTTCGCGCAG CGGGGCGCCA TCGCCATCCC
CTGCCGCGTC GACCGCTTCG TCCACGTCGA GCACCTCATC GTCCAGGACC TCCACGGCGC CGCCGCCTCC CACCTCCTCG
ACCTCGACTC CTCCTCCCAC CACCACACCC AGATCCACCT CCACCTCCCC CGCTTCGCCG GTTGCTTCCG CGCCTGATCC
TTCCATCATC TCCATGGATG CATCGCCATG GCGGTGGAGC GGAGCTCCCA GATTGCTCTT CTTCTTCTTC TTCAGGGTTG
GTTGGTCGAT TAATTACTTA GTTTAGCTAG TTTTTTGGTT TCCTTTTGCT TCGTCCTCCG ATCTCTCGGT TTGTTGGGGA
TGGATTTCGA TTGGGTTTGT GGACGGGAGA ATCGGAGGAC GGATTCGATG CTGATGACGA CGAAAAATTG AGATCGATCT
CAAAAGTGTA AAGACAGAGT AATTCTTCTT AGTAGCTTTA TTCTAGTTTT ATTTTTTTTA TCTTTTTTCT TTGCTTGTAC
ATCCACTTCT TGAAACACAT CAATAATACA GTATACTTTG ATCG

Locus: Os10g0510500

Loading...

Locus: Os10g0510500

Loading...