Os10t0512400-01

Locus

Os10g0512400

Description

Coniferaldehyde 5-hydroxylase, Lignin biosynthesis

RAP-DB Gene Symbol Synonym(s)

CYP84A5, F5H1, OsCAld5H1

RAP-DB Gene Name Synonym(s)

coniferaldehyde 5-hydroxylase 1, ferulate 5-hydroxylase 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsF5H1, F5H1, OsCAld5H1, CAld5H1, CYP84A5, OsCYP84A5

Oryzabase Gene Name Synonym(s)

ferulate 5-hydroxylase 1, Coniferaldehyde 5-hydroxylase 1

Transcript Evidence

AK067847

Protein Evidence

Q109F2

Literature

PMID: 28421330

Note

Manual Curation

April 21, 2017

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

J013124D03 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0512400-01)

RiceXPro (AK067847)

Others

Oryzabase (16716)

KEGG (Os10t0512400-01 (EC:1.14.-.-))

Transcript

2088 bp

>Os10t0512400-01 Coniferaldehyde 5-hydroxylase, Lignin biosynthesis
AGCTCTACACCAAGAGCGCTTATAAACATAAAAAACATCTCAAACACAACCCAAAATAGG
GCCAAAATTCTAGAATATTATTTTTGTTTTGAAAGGAATTTAAGTTTGTGTGGTGTGTCA
TCCATGGCGGACATGGTGAAGTTCACCATGGAGTGGCTTCAGGATCCTCTGAGCCTGGCG
ATCGTCGTCACGGTGGCCGTCCTAATCATGCGGATGCAGCGGCGGCGCGCGGCGCCGTTC
CCGCCGGGGCCGAAGCCGCTGCCGATCGTCGGCAACATGGCGATGATGGACCAGCTGACG
CACCGCGGCCTGGCAGCGCTGGCGAAGGAGTACGGCGGCCtgatgcacctccggctcggc
cggctccacgcgttcgccgtgtcgacgccggagtacgcgcgcgaggtgctccaggcgcag
gacggcgcgttctcgaacaggccggcgaccacggcgatcgcctacctcacctacgaccgc
gcggacatggcgttcgcgcactacgggcccttctggcgccagatgaggaagctgtgcgtg
gtgaagctcttcagccggcgccgcgccgagacgtggctcgccgtgcgcgacgagtccgcg
gcgctcgtgcgcgccgtggcggcgtcgcgcggcgaggccgccgtcaacctcggcgagctC
ATCTTCAACCTCACCAAGAACGTCATCTTCCGCGCCGCGTTCGGCACGCGCGACGGCGAG
GGGCACGACGAGTTCATCGCCATCCTCCAGGAGTTCTCCAAGCTGTTCGGCGCGTTCAAC
ATCGGCGACTTCATCCCCTGGCTCAGCTGGGCGGACACCAACGGCATCAACGCCCGCCTC
GTCGCGGCGCGCACCGCGCTCGACAGGTTCATCGACAAGATCATCGACGAGCACATGGAG
CGCGGCAAGAACCCCGACGACGCCGACGCCGACATGGTCGACGACATGCTCGCGTTCCTC
GCCGAGGCCAAGCCGCACGCCGGCAAGGCCGCCGCCGCCGCCGCCGGCGCCGGCGACGGG
GCCGACGACCTGCAGAACACGCTCCGCCTCACCCGCGACAACATCAAGGCCATCATCATG
GACGTGATGTTCGGGGGGACGGAGACGGTGGCGTCGGCGATCGAGTGGGCGATGGCGGAG
ATGATGCACAGCCccgacgacctccgccgcgtgcaggaggagctcgccgccgtggtgggc
ctcggccgggacgtcgccgagtccgacctcgacaagctccccttcctccgctgcgtcatc
aaggagacgctccgcctccacccgcccatcccCATCCTCCTCCACGAGACCGCCGCCGAC
TGCCTCGTCGCCGGCTACTCCGTCCCCAGGGGCTCCCGCGTCATGGTCAACGTGTGGGCC
ATCGCCCGCGACCGCGCCGCCTGGGGCCCCGACGCCGACGCGTTCCGCCCCTCGCGGTTC
GCCGCCGGCGCCGCCGCCGAGGGGCTCGACTTCAGGGGCGGCTGCTTCGAGTTCCTCCCC
TTCGGCTCCGGCCGCCGCTCGTGCCCGGGCATGGCGCTGGGGCTCTACGCGCTCGAGCTC
GCCGTCGCGCGGCTCGCCCACGGCTTCAACTGGTCGCTCCCCGACGGGATGAAGCCGTCC
GAGCTCGACATGTCCGACATCTTCGGCCTCACCGCGCCGCGCGCCACCCGCCTCTCCGCC
GTCGCCACGCCCCGGCTCACCTGCCCCTTGTACTGACGGCGGCCGGCGACCGCGGCGGCG
TACGGCAAGAATGGTTTGCAGGTGATGGTGTTAAAAGTTCAGACGCGTGTGGCGCCATTG
GAGGAGCTTGGTGTGGCTAGCTTAGCTTCCTCTGGGCCTTTTTTTTTTTGCTGGTTTAAT
TTTCTTTTTTTTTTCTCCTTTGTAATTTAATCCATGTCTCCAGAACAATAAGTGGATTAG
TAGGGTATAATTAAGGGTGACAGTGTGATATATAGACTATAAGATCAAAGTTGTAAATTT
GGTGTCCGGTGTGCCTGTCCACATAAGCACAGCCTCTGAATTTTCTTGTAAAACTTTGTC
ATGAAAATTGAGAAAGAAAACACctcgctttccacgcgtacgcttacc

CDS

1593 bp

>Os10t0512400-01 Coniferaldehyde 5-hydroxylase, Lignin biosynthesis
ATGGCGGACATGGTGAAGTTCACCATGGAGTGGCTTCAGGATCCTCTGAGCCTGGCGATC
GTCGTCACGGTGGCCGTCCTAATCATGCGGATGCAGCGGCGGCGCGCGGCGCCGTTCCCG
CCGGGGCCGAAGCCGCTGCCGATCGTCGGCAACATGGCGATGATGGACCAGCTGACGCAC
CGCGGCCTGGCAGCGCTGGCGAAGGAGTACGGCGGCCtgatgcacctccggctcggccgg
ctccacgcgttcgccgtgtcgacgccggagtacgcgcgcgaggtgctccaggcgcaggac
ggcgcgttctcgaacaggccggcgaccacggcgatcgcctacctcacctacgaccgcgcg
gacatggcgttcgcgcactacgggcccttctggcgccagatgaggaagctgtgcgtggtg
aagctcttcagccggcgccgcgccgagacgtggctcgccgtgcgcgacgagtccgcggcg
ctcgtgcgcgccgtggcggcgtcgcgcggcgaggccgccgtcaacctcggcgagctCATC
TTCAACCTCACCAAGAACGTCATCTTCCGCGCCGCGTTCGGCACGCGCGACGGCGAGGGG
CACGACGAGTTCATCGCCATCCTCCAGGAGTTCTCCAAGCTGTTCGGCGCGTTCAACATC
GGCGACTTCATCCCCTGGCTCAGCTGGGCGGACACCAACGGCATCAACGCCCGCCTCGTC
GCGGCGCGCACCGCGCTCGACAGGTTCATCGACAAGATCATCGACGAGCACATGGAGCGC
GGCAAGAACCCCGACGACGCCGACGCCGACATGGTCGACGACATGCTCGCGTTCCTCGCC
GAGGCCAAGCCGCACGCCGGCAAGGCCGCCGCCGCCGCCGCCGGCGCCGGCGACGGGGCC
GACGACCTGCAGAACACGCTCCGCCTCACCCGCGACAACATCAAGGCCATCATCATGGAC
GTGATGTTCGGGGGGACGGAGACGGTGGCGTCGGCGATCGAGTGGGCGATGGCGGAGATG
ATGCACAGCCccgacgacctccgccgcgtgcaggaggagctcgccgccgtggtgggcctc
ggccgggacgtcgccgagtccgacctcgacaagctccccttcctccgctgcgtcatcaag
gagacgctccgcctccacccgcccatcccCATCCTCCTCCACGAGACCGCCGCCGACTGC
CTCGTCGCCGGCTACTCCGTCCCCAGGGGCTCCCGCGTCATGGTCAACGTGTGGGCCATC
GCCCGCGACCGCGCCGCCTGGGGCCCCGACGCCGACGCGTTCCGCCCCTCGCGGTTCGCC
GCCGGCGCCGCCGCCGAGGGGCTCGACTTCAGGGGCGGCTGCTTCGAGTTCCTCCCCTTC
GGCTCCGGCCGCCGCTCGTGCCCGGGCATGGCGCTGGGGCTCTACGCGCTCGAGCTCGCC
GTCGCGCGGCTCGCCCACGGCTTCAACTGGTCGCTCCCCGACGGGATGAAGCCGTCCGAG
CTCGACATGTCCGACATCTTCGGCCTCACCGCGCCGCGCGCCACCCGCCTCTCCGCCGTC
GCCACGCCCCGGCTCACCTGCCCCTTGTACTGA

Protein

531 aa

>Os10t0512400-01 Coniferaldehyde 5-hydroxylase, Lignin biosynthesis
MADMVKFTMEWLQDPLSLAIVVTVAVLIMRMQRRRAAPFPPGPKPLPIVGNMAMMDQLTH
RGLAALAKEYGGLMHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATTAIAYLTYDRA
DMAFAHYGPFWRQMRKLCVVKLFSRRRAETWLAVRDESAALVRAVAASRGEAAVNLGELI
FNLTKNVIFRAAFGTRDGEGHDEFIAILQEFSKLFGAFNIGDFIPWLSWADTNGINARLV
AARTALDRFIDKIIDEHMERGKNPDDADADMVDDMLAFLAEAKPHAGKAAAAAAGAGDGA
DDLQNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMHSPDDLRRVQEELAAVVGL
GRDVAESDLDKLPFLRCVIKETLRLHPPIPILLHETAADCLVAGYSVPRGSRVMVNVWAI
ARDRAAWGPDADAFRPSRFAAGAAAEGLDFRGGCFEFLPFGSGRRSCPGMALGLYALELA
VARLAHGFNWSLPDGMKPSELDMSDIFGLTAPRATRLSAVATPRLTCPLY*

5'UTR

chr10:19734886..19735008 (- strand) : 123 bp

CDS

chr10:19733929..19734885 (- strand) : 957 bp

chr10:19728637..19729272 (- strand) : 636 bp

3'UTR

chr10:19728265..19728636 (- strand) : 372 bp

FASTA

>Os10t0512400-01 class=Sequence position=chr10:19728265..19735008 (- strand)
AGCTCTACAC CAAGAGCGCT TATAAACATA AAAAACATCT CAAACACAAC CCAAAATAGG GCCAAAATTC TAGAATATTA
TTTTTGTTTT GAAAGGAATT TAAGTTTGTG TGGTGTGTCA TCCATGGCGG ACATGGTGAA GTTCACCATG GAGTGGCTTC
AGGATCCTCT GAGCCTGGCG ATCGTCGTCA CGGTGGCCGT CCTAATCATG CGGATGCAGC GGCGGCGCGC GGCGCCGTTC
CCGCCGGGGC CGAAGCCGCT GCCGATCGTC GGCAACATGG CGATGATGGA CCAGCTGACG CACCGCGGCC TGGCAGCGCT
GGCGAAGGAG TACGGCGGCC tgatgcacct ccggctcggc cggctccacg cgttcgccgt gtcgacgccg gagtacgcgc
gcgaggtgct ccaggcgcag gacggcgcgt tctcgaacag gccggcgacc acggcgatcg cctacctcac ctacgaccgc
gcggacatgg cgttcgcgca ctacgggccc ttctggcgcc agatgaggaa gctgtgcgtg gtgaagctct tcagccggcg
ccgcgccgag acgtggctcg ccgtgcgcga cgagtccgcg gcgctcgtgc gcgccgtggc ggcgtcgcgc ggcgaggccg
ccgtcaacct cggcgagctC ATCTTCAACC TCACCAAGAA CGTCATCTTC CGCGCCGCGT TCGGCACGCG CGACGGCGAG
GGGCACGACG AGTTCATCGC CATCCTCCAG GAGTTCTCCA AGCTGTTCGG CGCGTTCAAC ATCGGCGACT TCATCCCCTG
GCTCAGCTGG GCGGACACCA ACGGCATCAA CGCCCGCCTC GTCGCGGCGC GCACCGCGCT CGACAGGTTC ATCGACAAGA
TCATCGACGA GCACATGGAG CGCGGCAAGA ACCCCGACGA CGCCGACGCC GACATGGTCG ACGACATGCT CGCGTTCCTC
GCCGAGGCCA AGCCGCACGC CGGCAAGGCC GCCGCCGCCG CCGCCGGCGC CGGCGACGGG GCCGACGACC TGCAGAACAC
GCTCCGCCTC ACCCGCGACA ACATCAAGGC CATCATCATG GTACGTGCAG TTGACAACCT ACTAGTAATT AATTACTGCC
AAATTTTTCA CCAACTTAAT CTCTCTATCA CGGTAATGAT TAATTACCAC TTACTCCTCC CGGCCGATCA AGATAAAACC
CGATCGAAAT TAGGCAACAC CAAATCCGTA AAATTACTGG AATTAATGAT TCACCGATtt agagcaagtt tgatagtata
gccaactatt aactctaaat catctatagc aaatataata gctaatttat acaatagtta cttactatac tattaatatc
tggtcccacc tgtcatacac acattacgtc ttagagttcg tgctgcagct ggctatagat tttgtagccc gctgctcttt
tctctcttgc tttatctttt taaaatatat ttatagttgg cttacttata gcctgctatt gtaactactc ttaCACAGCA
CAGCAGTATG GAGTAGTAAT ATATATCTTA AACTCTGACA ATTAAACATG ATAAATTCAT CTGACGCAAA CACAACTGTA
CGCTATAAAT ACGCGTACAA ATCAGCAACA GTAGTGTACG GGGCCGGATT ATTAGTCAGG TAATATATCA TTTTATTTTA
GGCGATTAAG TCAGGCAAAT TATCTTGATC CGTGTAGATT ATTTGACAGG GCAGAGATCT CTCCTGGTAT AGTTGACATG
AACACCATGT GCAGTCCATG TGTGTGTTCG CCTCGTTTGC AGGTGAATCG ATATGATCAA CCGTTAGATG GCGCCACGTA
TGCATCATGG ATCATAGATT AAGCCCTGCA AATTAAAGCC ACTCAATGAA ATGCTAGATT TGAGGAGTAA TTAATTTTAG
TGTAGAATAC AGTGGTCCTC CTTGATGCAT CCCTCGCAAT GTATCTGCAC TTCTACAGGC AGTCAACTCA CTTACATAAG
CATTGTCGAC TGTTCCCGAG GAGATCGACA CCGTCAGATA CGGCATTAAC CTATGATTAT TTATACCCAT ATTTCAATAT
ACGGGTAGTA AAATATTCCG AGAATTTTAT GGAGTAGCAC GTACTCGGAG GAAGTAGTAA AAATAGCTTT GTACTTATCC
CTCCGTTGTA TAAAATATCC AATCCTTACC ATGTACTTCC TCCGTAaagt cgttttgaac aacgatacgg tctccaaaat
acaactttga tttcttgttt ctataaaaat atctattaaa aagtaatata tgtatacttt tatgaaaata tttttcaaga
caaatctatt catataattt ttacattttc aaactcaaca acttaagagt tattcatgat ttatattcct aagatttgac
ttaaaaacag tcctaaacga cttcctttac aagcacagag ggagTACCCG GATATATACG TGTCTAGTTA CGTGGCTAGA
AATTGTCTCT CTCTTTTTCT TTTTTTTCTT TTTTGATATA GTAGTATATC GGATACAGCT AGAAGTAACT ATAGTGTTAG
CCTTTTTTAG CGAATAAAGG TAGAAGCTAA TCTTTAACCA CGTTCTGGTA GGATGACAGC TCTAATTTTA TTTCACATCT
TTTAGATGTG GATGTTTTCA GCGTGTAATA TATATCTCCT TTTTCAAAAA AAAAACCTAT ATTTTAAACG AACTTATATA
GGAATTTTCA GTGGTAGACT GAATAAGTGT TTTGACTTGC TGGTAGAACG ACTGGATATT TGCACACACG AATAATCTTA
CAGTCGCTTG GCGCAACAGC CAACCTAGCT TGAGGCTCAA ATTAAAGTCA GAGCACGAGC CTGACCAACG CCGGCCGGCG
GCGGGTCTTC TCCGGCGCCG GCGGCCGGTG ATCGATTTCA TTTCCAGGCT TATTCTCCGC GTATGCATGA TGTGTCAAGC
TACTGAGCTA TAGCTAGCCG TCTCTCTCGT GTACGAGTCT CTTACCACTC TTGGCTAGCA AATCTGACGA CTCTTTGACT
GAACGAACAA CTCGTACGTC TTAAAAGCCA AGAAAACAAC CCCGGTAGGC TGTAGGTGTG TTCAAGGGGT ATTTTGATTT
GGTACCTATA TATTCTTGTC TTTATCAATT AATTCGTTTG TAATAAATTG TACTTACATG TTAACTATTT GAATTAGACC
TAAAGTATAC CAAATCAATA GAGTGGTGTC AAACAGGCAC TACCAAATAA AAAAAATGCC TACTAGCAAT TTTTATTAGG
GTTTGAAACC ATACAAATCC TAAGTTATCT TTGTGATACT ATTGTCGTCG GCCTCACCCA TGGTTTGCAT ATGGTTGAAT
ATATCTGGGA TTTTTTTTCA CTTAAACGGA CATCTCCTTG TTAttatttt aaaaaaaatt gacaataaag aatattatgt
aatatttcaa tctaaaaata tataagttta aatttaactt ttaaaatata ttaaaaataa taaatattat tttgaatgtc
tgtatactag ctatagttta atttgttttt ttaataactt gtggaagtta aacttagcat tattcgtgtg cgaagtgata
tatatcatat taatttattt tatagaaaaa gaattttttt ataactgttt gagtggccta agaaaAATAA TGGAACATCC
TCTCGAGGAA TAAAAATTCA TCTCCAATAT ATTTACTGTG TTGATCTTTC GCTGGTGTGT TATAGTGTGC GTCCGTCTTC
TTTTTTTGCC TTGTCAACCT ATTACGTACT GTCATGTATG TTAACGGACT TGTTAGGGAA GCAAACTGTG AGTATGTCTT
GTTTATTTTT CTTGGTTTTC TACCTAACTA TTACTATCAT GTATGTTAGT GTACTTGTTA GGGAAGCAAC CATGAGTTAG
GAGACATACG TAATTTGTTG GACTGTTGGG TGTGTGTGGT GTATTTTTGT GGCTAGAGTT AATTTGGATT TTTATTATTT
TAGTTCTTTA AAAAAATTAA AATTTCTCAT TGATTTTTTT GGCATTAAGA TAATTTTATA AAACCATGAA AATAGTGAAT
TCATTCATCT GTCTATTACC ATGTTTTAAC GATTGGAGAG CACATATTAA CATGAATGCA TTTTGCACTT AGTACCTCCA
TTGTTTTTTT TTTGGGATCG AAATACATCA CGTAATAACA CCTAGGAACG TACGCAACAT CATTTTCAAC TTTTAAGACC
CCTTTCTCCA ATAATTGAAA AATTAAACAT GAACCAACCT ATTGAACTTC TATGTATGTC ACCATCATCG CATCTCCCTT
TTAACCtact ccctatgttt cacattataa attgttttcg gctagtcaaa attattctaa tctaattaag tttataggat
aaaacgtaaa agcattttta aaacaaagca aacatataaa aatatagtaa atgatagatt taatgaaaac aaattttgta
ttataaatgt tgctaatttt tttataaact tgactaaatg ttaaaaagtt tgacttaaga taaactctaa atggcttatg
atgtgaaacC TGGATAGTAA GTCCATATAG ATAGGCTCTG GCCATATTGG TGCATGTCAC CCTCCAAAGT AAAATCTTCA
TTTATCTGGC CCCAACGGCC GCTCAATACT TTAGACCAAC CAAATCATTT CCTTCCATCT CACGGTAACA AAATGAATGA
TGTTTTTATT GTCTCTTCAT CTTTGCACAT TAAAAAAGTG AAAACTTTAT AACATCATTA CTGGTAAGCA TTACGCAACA
TGGCACTGAC TTCTTGTCTG AATGTACACA AGCAACAGCT TGTTTTTATA GGACAAAATG ACAACATATT GCCCTGTTGG
AACTTAGATG TACATTTGTC ATGTAAGGAT AATATTAAAA TGAAATCTGT TGATAGGAAA AGTGAAATTT TCTTTCTACC
ACTACCTAAT ATGTGGTCCT ACCTATGTAT ACGTAAGATT GGCACAAGTA AATTTGGTAT GGAAAATTGT ATTATTATAC
TTTTATtaat ccctccggtt tttttagtac gacgtcatga atgttggata catgcttgaa catttatctt atttaaaaaa
ttagtcaatt attatttgtg atattgtgat ttattttatc actaaatgta tcttgagcat aatatttaat tcttttttat
atttgcacaa atttttgaat aaattgaaca atcaaatagt taaatgtatt tccaaaagtA CCATATACTA GTTATgtttt
ttaataggta atgccgttga ctttcagaca cacatttgac cattcatctt atattaaata atatatataa taattatcat
ttattttgtt atgagttatt ttatcagtaa aagtacttta agcatgattt ggaacttatg catttgcaca aaactttaaa
agtaaaacgg atgatcaaat acgtgtctaa aattcaatag tgtcatctat taaaaaCAAA AATAGTATTA AAAACAGTGG
TGGAGCCACC GCCTGGGATC ATCGCAGCGA ACACACTGTA AAATTTGATA TATTATAGAA TTGAAAACAA AATTTTCATA
GCAAATACTT GTTGTAGTTA GATTTACCCG AGCATCGTAA ATTTTCTAGT CTCTGCCACT GATTAGAAAT GGAGGGAATA
ATAAGTAAAC AACAAGTAGT GTGAGTAATA AGCAAAGGTG ATGACGTGGC ATGCAGGACG TGATGTTCGG GGGGACGGAG
ACGGTGGCGT CGGCGATCGA GTGGGCGATG GCGGAGATGA TGCACAGCCc cgacgacctc cgccgcgtgc aggaggagct
cgccgccgtg gtgggcctcg gccgggacgt cgccgagtcc gacctcgaca agctcccctt cctccgctgc gtcatcaagg
agacgctccg cctccacccg cccatcccCA TCCTCCTCCA CGAGACCGCC GCCGACTGCC TCGTCGCCGG CTACTCCGTC
CCCAGGGGCT CCCGCGTCAT GGTCAACGTG TGGGCCATCG CCCGCGACCG CGCCGCCTGG GGCCCCGACG CCGACGCGTT
CCGCCCCTCG CGGTTCGCCG CCGGCGCCGC CGCCGAGGGG CTCGACTTCA GGGGCGGCTG CTTCGAGTTC CTCCCCTTCG
GCTCCGGCCG CCGCTCGTGC CCGGGCATGG CGCTGGGGCT CTACGCGCTC GAGCTCGCCG TCGCGCGGCT CGCCCACGGC
TTCAACTGGT CGCTCCCCGA CGGGATGAAG CCGTCCGAGC TCGACATGTC CGACATCTTC GGCCTCACCG CGCCGCGCGC
CACCCGCCTC TCCGCCGTCG CCACGCCCCG GCTCACCTGC CCCTTGTACT GACGGCGGCC GGCGACCGCG GCGGCGTACG
GCAAGAATGG TTTGCAGGTG ATGGTGTTAA AAGTTCAGAC GCGTGTGGCG CCATTGGAGG AGCTTGGTGT GGCTAGCTTA
GCTTCCTCTG GGCCTTTTTT TTTTTGCTGG TTTAATTTTC TTTTTTTTTT CTCCTTTGTA ATTTAATCCA TGTCTCCAGA
ACAATAAGTG GATTAGTAGG GTATAATTAA GGGTGACAGT GTGATATATA GACTATAAGA TCAAAGTTGT AAATTTGGTG
TCCGGTGTGC CTGTCCACAT AAGCACAGCC TCTGAATTTT CTTGTAAAAC TTTGTCATGA AAATTGAGAA AGAAAACACc
tcgctttcca cgcgtacgct tacc

Locus: Os10g0512400

Loading...

Locus: Os10g0512400

Loading...