Os10t0520700-01

Locus

Os10g0520700

Description

Zinc finger, HIT-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

LIP1

CGSNL Gene Name

LC3-INTERACTING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsLIP1

Oryzabase Gene Name Synonym(s)

LC3-interacting protein 1

Transcript Evidence

AK103797 (DDBJ, Best hit)

Protein Evidence

B6TE25 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Zinc finger, HIT-type (IPR007529)

Full-length cDNA

J033145P15 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0520700-01)

RiceXPro (AK103797)

Others

Oryzabase (22843)

KEGG (Os10t0520700-01)

Transcript

1567 bp

>Os10t0520700-01 Zinc finger, HIT-type domain containing protein.
GCCGCGGCGCACACCGGAATCCACCgccgacgctccggcgccaccgagggagggggtgag
gaacgcgggggagaagcgtcgtaggcgaggtgccggcgatggagagggaagtcgtggtct
ccgaggacgcggccgcctcctccTCCTCCTCCTCCTCCTCCGCCGCCGCCGCCTCGTTCT
CCCTCGCGGAAACCAGGGTCATCTGCCGCGTGTGCCAGAAGCAGTTCGCGCAGTACACTT
GCCCCCGTTGTAACGCCCGGTACTGCTCGCTCCCGTGCTACAAGGGGCATAGTGTTCAGT
GCACTGAATCCTTCATGCGTGAGAATGTTATGGATGAGCTTAAGCAGATGCAACCTGAAG
ATGAATCAAAGAAGAAGATGTTAGACATACTTAAAAGGTTCCACTTGGAAGAAGAAGATA
TGGATTCAGAAGGCGAAGATGAGTCAATTCTGTCAGAGGAGCTTATTCAAAAAGTTATGT
CTGGAGATGAGATCAAGCTTGAAGACCTCTCTGATGATGAAATCAAACGATTTCGTCAAG
CTCTGGCTTCAGGTGAACTCAGCAAGATGATCGAGCCATGGACACCATGGTGGAAAAAAC
CTTCCGCTAGATCGATTTCCCTCAGTCCAGATGGAAGCCAGCTTATCAGACAAGTGAGTG
TAGAAGACACTGATACGTCAGATCCAATGGCTGACCCAGAGTCTAGCATCAGTGAAATCC
CAGAAGGGCCAGAATCTGCTCTCCCGTCACTCGAACAGCTAACCAGAGCGGAGCCATCTC
CGCTGCTTGCGGTTCACTTGGTTGATATACTGTACAGTTACTGCTTCACACTTCGCCTCC
ACAATGGCGATTGGCGCTCTGATCCTTTTGGTGCCTCTACTGTTGCGTTGTCTGTGTCAA
AAGTCATGGGGGAGGATGCTAAACCTGAGACAGTATCTGAAGCCCTCACGGCATGTATAG
AGGAGACATGCTCACCGGCTTACAGGCACACCGGAGGTTTCAGGTTTGCTATAGCTCTCG
TGGATGATATCATCAGCCTTCTCACGTTAGGAGGCAATGCGCTTGTTTGTGCCCTCTGTG
ACTTCCGCAGGCTCATTCATATCGGTGAGAGGATGCTCAAGGCAGAGAAATTGGGCAAGG
CGGAGCGATCACGGAGCACCCAAAAGCTTCGTGCCGCAGATAGGAAGTTGTACTTCATGA
CATGCTGGGTTCATGAGCAACCAAATGAGGCATGGTCGTCTTTAGCTCGCCTCGTTGAGG
TGCAGAAAGCATCTCTGGAGGAGTTGGATTGCGGGAGTCAATTTCAAAGGGCTGGTAGAA
AGAACGATGCCCAATCCAAGGTTCTTATTGAGGAGATTTGAGCGTGAGAATGTATTGATG
CAAGTGATACTCATAATCTTCTTACCCCTATATCAGCTGTATCATGTATGGCTGTATAAT
CTTTGTTGTAAAGAACTTCGGATGTTACTTCCCCATGAGTTTCTGATGTCAAATCTGATA
TGTTAAAGGAGTTGTATGCAATTCTGAAATCCTGATATGAAAGCCATATTGGCAGAATTC
AGATGCC

CDS

1263 bp

>Os10t0520700-01 Zinc finger, HIT-type domain containing protein.
atggagagggaagtcgtggtctccgaggacgcggccgcctcctccTCCTCCTCCTCCTCC
TCCGCCGCCGCCGCCTCGTTCTCCCTCGCGGAAACCAGGGTCATCTGCCGCGTGTGCCAG
AAGCAGTTCGCGCAGTACACTTGCCCCCGTTGTAACGCCCGGTACTGCTCGCTCCCGTGC
TACAAGGGGCATAGTGTTCAGTGCACTGAATCCTTCATGCGTGAGAATGTTATGGATGAG
CTTAAGCAGATGCAACCTGAAGATGAATCAAAGAAGAAGATGTTAGACATACTTAAAAGG
TTCCACTTGGAAGAAGAAGATATGGATTCAGAAGGCGAAGATGAGTCAATTCTGTCAGAG
GAGCTTATTCAAAAAGTTATGTCTGGAGATGAGATCAAGCTTGAAGACCTCTCTGATGAT
GAAATCAAACGATTTCGTCAAGCTCTGGCTTCAGGTGAACTCAGCAAGATGATCGAGCCA
TGGACACCATGGTGGAAAAAACCTTCCGCTAGATCGATTTCCCTCAGTCCAGATGGAAGC
CAGCTTATCAGACAAGTGAGTGTAGAAGACACTGATACGTCAGATCCAATGGCTGACCCA
GAGTCTAGCATCAGTGAAATCCCAGAAGGGCCAGAATCTGCTCTCCCGTCACTCGAACAG
CTAACCAGAGCGGAGCCATCTCCGCTGCTTGCGGTTCACTTGGTTGATATACTGTACAGT
TACTGCTTCACACTTCGCCTCCACAATGGCGATTGGCGCTCTGATCCTTTTGGTGCCTCT
ACTGTTGCGTTGTCTGTGTCAAAAGTCATGGGGGAGGATGCTAAACCTGAGACAGTATCT
GAAGCCCTCACGGCATGTATAGAGGAGACATGCTCACCGGCTTACAGGCACACCGGAGGT
TTCAGGTTTGCTATAGCTCTCGTGGATGATATCATCAGCCTTCTCACGTTAGGAGGCAAT
GCGCTTGTTTGTGCCCTCTGTGACTTCCGCAGGCTCATTCATATCGGTGAGAGGATGCTC
AAGGCAGAGAAATTGGGCAAGGCGGAGCGATCACGGAGCACCCAAAAGCTTCGTGCCGCA
GATAGGAAGTTGTACTTCATGACATGCTGGGTTCATGAGCAACCAAATGAGGCATGGTCG
TCTTTAGCTCGCCTCGTTGAGGTGCAGAAAGCATCTCTGGAGGAGTTGGATTGCGGGAGT
CAATTTCAAAGGGCTGGTAGAAAGAACGATGCCCAATCCAAGGTTCTTATTGAGGAGATT
TGA

Protein

421 aa

>Os10t0520700-01 Zinc finger, HIT-type domain containing protein.
MEREVVVSEDAAASSSSSSSSAAAASFSLAETRVICRVCQKQFAQYTCPRCNARYCSLPC
YKGHSVQCTESFMRENVMDELKQMQPEDESKKKMLDILKRFHLEEEDMDSEGEDESILSE
ELIQKVMSGDEIKLEDLSDDEIKRFRQALASGELSKMIEPWTPWWKKPSARSISLSPDGS
QLIRQVSVEDTDTSDPMADPESSISEIPEGPESALPSLEQLTRAEPSPLLAVHLVDILYS
YCFTLRLHNGDWRSDPFGASTVALSVSKVMGEDAKPETVSEALTACIEETCSPAYRHTGG
FRFAIALVDDIISLLTLGGNALVCALCDFRRLIHIGERMLKAEKLGKAERSRSTQKLRAA
DRKLYFMTCWVHEQPNEAWSSLARLVEVQKASLEELDCGSQFQRAGRKNDAQSKVLIEEI
*

5'UTR

chr10:20144751..20144848 (- strand) : 98 bp

CDS

chr10:20144638..20144750 (- strand) : 113 bp

chr10:20144488..20144560 (- strand) : 73 bp

chr10:20143478..20143634 (- strand) : 157 bp

chr10:20142341..20142382 (- strand) : 42 bp

chr10:20140872..20141749 (- strand) : 878 bp

3'UTR

chr10:20140666..20140871 (- strand) : 206 bp

FASTA

>Os10t0520700-01 class=Sequence position=chr10:20140666..20144848 (- strand)
GCCGCGGCGC ACACCGGAAT CCACCgccga cgctccggcg ccaccgaggg agggggtgag gaacgcgggg gagaagcgtc
gtaggcgagg tgccggcgat ggagagggaa gtcgtggtct ccgaggacgc ggccgcctcc tccTCCTCCT CCTCCTCCTC
CGCCGCCGCC GCCTCGTTCT CCCTCGCGGA AACCAGGGTC ATCTGCCGCG TGTAAGCCTC GGCGTTCCTC CTCCCCGGTC
TCGCGCTACG TGCCTAATCG TGATCGTGTG AGCTTACGGT TGTTGCAGGT GCCAGAAGCA GTTCGCGCAG TACACTTGCC
CCCGTTGTAA CGCCCGGTAC TGCTCGCTCC CGTGCTACAA GGTGCGTGCG ATTTCCCTCT CGCTTCTGCT GCTCCCGTAC
TGCGGGCTTC GTGCTCTTCG AGGCTCGCTG CTTGTAGAAC ACCTCCAGGG AGGGTTCATG CTCGTGTTGG TTTGGTGTCG
TGGGTGTCTC AGTGAGTTAG TGCTGACGCA CACAAGGTGT TTGTAGAATT GCAGCAATGA GTTCGTATAC TTTTTGGAAG
AGTAATTTTG GTTTATATGC TAAAAGCGTA TATCTGAGTC TGGTACAAAT GGAAATGGTT AAGTTACTTG CAGTCACACT
GATATGGTGC ATTTCCGTTG CTAATTAGGC TGCAGAAATT CCCTCCTTGT GCTGTCCAAT GTAGTTTCAT GAAAAGGGTT
GCATTACTAG CTGGATGGCT AATGTGCTGA ACTTAAGAAA TTTCAACTAT CATATGGAAC AGAAAAGATG AATTGAAAGC
GCATTTGTCC TTTCCAACGG CATAGGTTAT TCTAGTTCCT CACTATGGGT CTGTTAACAT TTCAAATGGC CACATGGTGT
AAACTTTCTG AGGAGGTTGG AATTTTTCTC ACATTCATTT AGATACCACC AATATACCAT ACAACAGCAT TAATGCTACC
CTGAGTGGAT TGTACCAGTG TGACTGAGAC TGTCAAATGA TTGTTGAAAG AGAATACATG TTTATCTACA AAACAACAAC
ATCGATTTAA GGGGTCTGCT TATATGGGTG CAATATATCT AACTCGAGGA ATTTACCATC TACATAATTG ACTAGTGAAT
TTATGCatat tgatctcaag gaataatgat gtttacatta ttgcaccttt tacttttgta acctcttata tcttatataa
ttcttgttCT GTAGGGGCAT AGTGTTCAGT GCACTGAATC CTTCATGCGT GAGAATGTTA TGGATGAGCT TAAGCAGATG
CAACCTGAAG ATGAATCAAA GAAGAAGATG TTAGACATAC TTAAAAGGTT CCACTTGGAA GAAGAAGATA TGGATTCAGA
AGGCGAAGAT GGTATGGTTG ATATGCATTC TTTTACATTA TGTCTGATAG TCTATAAACC ATTAGCTATC CTTTTCTGTA
AATATAAATG ATCGGGATTT GTTATTGGTG ATGAGGATGT TGCAAGTGCT CAGATTTTCC ACCTTAGGAT TGCATCTGCC
TCACTCTTAT TGAAACCATT ATTTTTATAA AGCGTGAATT ATTGCTTGTG TTTCTACTTA TTTATATTGC GCTTACGTGA
AGTATTACTA TTTAAGATTT TATGGTCAAA TTGAATTTTT AATCATTCTC TCCTAGTTTG TTTGCTCTGA AAACATATTA
TTATTAATTT TTCTATTTGC ATGCTATTTC ACTCTCAAAG CTGGTAGTGG TAGAAAAATC ATCTACTAGT TTGTCAGCAT
TAATATTTGT ACTCTTACTG CTGAACTTGG TAGTACAGGA ATGGATGTTT GTATCATGGA AAACAATAGA AGATGTGACG
ACTGTAATAC ATCTAAACTT ATAATTTCAT TAGTTTAAGG CCTGACTGGT TTCTGTTTAC CTATTTGTCA TCTAAATGGT
TTCGAGTACT CTTCTAGAAG ATCATACTTT CTCTAACACA GATAATATGT GATAATATAT TGTCTGGTCA GTGCTTATTA
CTAGTTGTGA AAGTTACCAT TTCTGTTCAG TTTCATAAGG AGATTATTCT GTTATGTCAT CTCTGTTTTA TACATAAAAT
GTTATGGTCG GGCTGACCTA CCAGAGACAC GGAAGGCTGT GACTCCTGCC AGTTAATTGT ACTCTATATC ACTAAAATAT
TATGAACAAA AGCCTAGTAC TGAATTACAA TTACCTCCTA CTATTAGGAA GGATGATCCC CTTGCTAACT ATGTGATTAT
GTGGATTGTA TAAATTTTTG CAATAGCTCT TTCAATAATC AAATCTTTGT TTGGCGCATC TAGCAGATTT TGGGCTTGTC
TAGTTTTGGT TATGATTTAA TGAGTTATGA GGGCCTACCT GTTGTGAATT GGTTGAGGTG ATTATGATTG TTGAGTGGTG
CATATGCTAT ATTTTGATAT GTGAGGATCT TTTCTTTTGA CATGTCATAC ATGTTTTGTC CTGCAGAGTC AATTCTGTCA
GAGGAGCTTA TTCAAAAAGT TATGTCTGGT ATGTGTGTAC TTCTCATGCC TTCCTAATGT GAATAAACCA TAGCATTTCA
CAGTGCTCTT ATTTTTATTT ATGAAAACCT AGGTATTCTT TAAACAATTG CACTAACCAA TCATTTCTTA ACACCTTTGT
TAACTAAATT TTTTTTGCAA CTAGTATAAG AAAAAACAAA TAACTGATTT AAGATAGACA AATGCTTGTG AAGGGAATTC
AGAGTTAGAC TTACCAATGT AAATTTTCAT GTGAGAATTA CGTTCAGTAT TCCTTTCCAT TAAAAGGTTG TGGATCAAAC
AAATTGCATC TGTAGTATAA GGATAACTTA GCCTGCCAAA TGCTGGCAAG CTGTCCTTTT TTGTCATTTT TACATTTACC
TCTGATTATT GTATTTTCAT GTTGAGTAAT TGCTTCATTT CTTGAAATAC AGTATTCAAG TTCTGTTCAT GTGGCTCATT
TTTTCAATTT TCATGCTGGA TGATAATTTG GCCTTGTCAT TTTTGGGATG GAACTTTTCT AAACAAGCAA ATATTGTTAT
GTACTTCAAG TTTTCTGCTG AGCTCTCATT AGATTAATAT TTGTTTGTTC TTCAAACAGG AGATGAGATC AAGCTTGAAG
ACCTCTCTGA TGATGAAATC AAACGATTTC GTCAAGCTCT GGCTTCAGGT GAACTCAGCA AGATGATCGA GCCATGGACA
CCATGGTGGA AAAAACCTTC CGCTAGATCG ATTTCCCTCA GTCCAGATGG AAGCCAGCTT ATCAGACAAG TGAGTGTAGA
AGACACTGAT ACGTCAGATC CAATGGCTGA CCCAGAGTCT AGCATCAGTG AAATCCCAGA AGGGCCAGAA TCTGCTCTCC
CGTCACTCGA ACAGCTAACC AGAGCGGAGC CATCTCCGCT GCTTGCGGTT CACTTGGTTG ATATACTGTA CAGTTACTGC
TTCACACTTC GCCTCCACAA TGGCGATTGG CGCTCTGATC CTTTTGGTGC CTCTACTGTT GCGTTGTCTG TGTCAAAAGT
CATGGGGGAG GATGCTAAAC CTGAGACAGT ATCTGAAGCC CTCACGGCAT GTATAGAGGA GACATGCTCA CCGGCTTACA
GGCACACCGG AGGTTTCAGG TTTGCTATAG CTCTCGTGGA TGATATCATC AGCCTTCTCA CGTTAGGAGG CAATGCGCTT
GTTTGTGCCC TCTGTGACTT CCGCAGGCTC ATTCATATCG GTGAGAGGAT GCTCAAGGCA GAGAAATTGG GCAAGGCGGA
GCGATCACGG AGCACCCAAA AGCTTCGTGC CGCAGATAGG AAGTTGTACT TCATGACATG CTGGGTTCAT GAGCAACCAA
ATGAGGCATG GTCGTCTTTA GCTCGCCTCG TTGAGGTGCA GAAAGCATCT CTGGAGGAGT TGGATTGCGG GAGTCAATTT
CAAAGGGCTG GTAGAAAGAA CGATGCCCAA TCCAAGGTTC TTATTGAGGA GATTTGAGCG TGAGAATGTA TTGATGCAAG
TGATACTCAT AATCTTCTTA CCCCTATATC AGCTGTATCA TGTATGGCTG TATAATCTTT GTTGTAAAGA ACTTCGGATG
TTACTTCCCC ATGAGTTTCT GATGTCAAAT CTGATATGTT AAAGGAGTTG TATGCAATTC TGAAATCCTG ATATGAAAGC
CATATTGGCA GAATTCAGAT GCC

Locus: Os10g0520700

Loading...

Locus: Os10g0520700

Loading...