Os10t0521000-01

Locus

Os10g0521000

Description

Trehalase, Salt stress tolerance

RAP-DB Gene Symbol Synonym(s)

OsTRE1

RAP-DB Gene Name Synonym(s)

TREHALASE 1

CGSNL Gene Symbol

TRE1

CGSNL Gene Name

TREHALASE 1

Oryzabase Gene Symbol Synonym(s)

OsTRE, OsTRE1

Oryzabase Gene Name Synonym(s)

trehalase 1

Transcript Evidence

AK108163

Protein Evidence

Q9FWC1

Literature

PMID: 30393190

PMID: 26233894

Note

Manual Curation

November 7, 2018

Gene Ontology (GO)

Biological Process: trehalose metabolic process (GO:0005991)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: alpha,alpha-trehalase activity (GO:0004555)

Functional domain (InterPro)

Six-hairpin glycosidase superfamily (IPR008928)

Six-hairpin glycosidase-like superfamily (IPR012341)

Glycoside hydrolase, family 37 (IPR001661)

Glycoside hydrolase, family 37, conserved site (IPR018232)

Full-length cDNA

002-139-H02 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0521000-01)

RiceXPro (AK108163)

Others

Oryzabase (9039)

KEGG (Os10t0521000-01 (EC:3.2.1.28))

Transcript

1986 bp

>Os10t0521000-01 Trehalase, Salt stress tolerance
CTGTCCCCTTACTCCGGCCGATTCACATGGCGCCCACCGCCGCGGTTGCCGGGGGTGGCG
TGGAGGCGGAGGCgctgctggggctgctgcagcgggtgcagtcggaggcgctgcgggcgt
tcgggccgaacgacttcgaccccaagctctacgtcgacctgccgctcgccgccgacgcca
gcgcggcggccgcgctggcgtcgctgccgcgggcggcgccgtcgaggggcgagatggAGG
CCTACATCTCGAGGTACTTCGCGCTGGCCGGGTCCGACCTCGTCgccgccgccgacccgc
cggacttcgagcgcgacccccccgggttcctgcccagggtggagcgcgccgaggcgcggg
cctgggcgctggaggtgcacgcgctgtggaaggacctgacgcggcgggtggcgccggccg
tcgcggcgcgccccgaccggcacacgctgctgccgcTCCCCGGCAGGGTGGTCGTGCCGG
GCTCCAGGTTCCGGGAGGTCTACTACTGGGACTCCTACTGGGTCGTCAGAGGTTTACTGG
TGAGCAAAATGTATGAGACGGCAAAGGATATCGTGCTTAATCTTGTGTATCTTGTTGAGA
AATATGGTTTTGTTCTGAACGGGGCAAGATCGTACTACACTAACCGAAGCCAGCCACCAC
TTTTAAGCTCCATGGTTTTAGACATATACATGGCAACTGGTGATATGGCTTTTGTGAGGA
GGGTATTTCCCTCACTGCTGAAAGAGCATAGTTTCTGGATGTCAGAGGTTCACAATGTGG
CAGTAATGGACAATCATGGACGGGTACATAATTTGAGTCGCTACCAGGCTATGTGGAACA
AACCTAGGCCAGAAAGTGCAACAATTGATGAGGAATTTGCTTCAAAACTTTCTACGGCTG
CTAAAGAAAAATTCTACCACCAAGTTGCTTCTACAGCTGAAACAGGATGGGATTTTAGCT
CTCGATGGATGAGGGATTCTACTGACATGACAACTCTGACAACATCTTGCATAATACCTG
TGGACTTGAACACATTCATATTGAAGATGGAACAGGACATAGCTTTCTTTGCTAAACTCA
TTGGAGAGAGCACAACATCAGAAATATTTTCAGAGGCTTCAAAAGCACGCCATAATGCAA
TTGATTCTGTTCTGTGGAACGCTGACATGGAGCAATGGCTTGACTACTGGCTTCCTACTG
ATGGAAACTGCCAGGGAGTCTACCAATGGAAATCTATCTCACAGAACCGCGCCATCTTTG
CTTCTAATTTTGTACCTTTGTGGTTAAATGCTCAACATTCAGGCTTGGAGCAATTTGTCG
ATGAGGCAAAATCAGTGAGAGTCATGAGAAGCCTCCAGAAATCAGGATTACTGCAACCTG
CAGGAATCGCAACTTCCTTATCAAACACAGGGCAACAATGGGATTTTCCAAACGGATGGG
CCCCGTTGCAGCATCTGATAGTCGAGGGATTGTTGAGGTCTGGTTCAGGAGAGGCAAGGG
AACTTGCTGAGGACATTGCCACGAGGTGGGTGAGAACAAACTATGATGCCTATAAGGCTA
CCGGCGCGATGCATGAGAAGTACGATGTGGTGACCTGTGGAAAATCTGGAGGTGGGGGTG
AATACAAACCCCAGACTGGTTTTGGTTGGTCCAACGGTGTGATATTATCATTCTTGGATG
AATTTGGATGGCCTCAGGACAAGAAGATAGACTGCTAGTCATCATGATGAATGTTAAACC
CCATCTTCGCAGATGCAGAATGTGGCTAGGCTAGGCAGGTGTTTTTGTGTGCAACTGTAT
ATACACGGCTGTGCATTACACGCAAAGTTGAAGAGGCATTCTGCAATTCTGCTGTAGTTT
TTATCTGACAAACATTTGCATTCAGATTTCAGAGCATCACCCGCAACTGTGTTTTTTTTT
CTTTTTTTGTAACTTGCCCTTTGCTGTAACTCGTATCAAAGCTCAAAGCAAGAAGAATCT
TCATGT

CDS

1692 bp

>Os10t0521000-01 Trehalase, Salt stress tolerance
ATGGCGCCCACCGCCGCGGTTGCCGGGGGTGGCGTGGAGGCGGAGGCgctgctggggctg
ctgcagcgggtgcagtcggaggcgctgcgggcgttcgggccgaacgacttcgaccccaag
ctctacgtcgacctgccgctcgccgccgacgccagcgcggcggccgcgctggcgtcgctg
ccgcgggcggcgccgtcgaggggcgagatggAGGCCTACATCTCGAGGTACTTCGCGCTG
GCCGGGTCCGACCTCGTCgccgccgccgacccgccggacttcgagcgcgacccccccggg
ttcctgcccagggtggagcgcgccgaggcgcgggcctgggcgctggaggtgcacgcgctg
tggaaggacctgacgcggcgggtggcgccggccgtcgcggcgcgccccgaccggcacacg
ctgctgccgcTCCCCGGCAGGGTGGTCGTGCCGGGCTCCAGGTTCCGGGAGGTCTACTAC
TGGGACTCCTACTGGGTCGTCAGAGGTTTACTGGTGAGCAAAATGTATGAGACGGCAAAG
GATATCGTGCTTAATCTTGTGTATCTTGTTGAGAAATATGGTTTTGTTCTGAACGGGGCA
AGATCGTACTACACTAACCGAAGCCAGCCACCACTTTTAAGCTCCATGGTTTTAGACATA
TACATGGCAACTGGTGATATGGCTTTTGTGAGGAGGGTATTTCCCTCACTGCTGAAAGAG
CATAGTTTCTGGATGTCAGAGGTTCACAATGTGGCAGTAATGGACAATCATGGACGGGTA
CATAATTTGAGTCGCTACCAGGCTATGTGGAACAAACCTAGGCCAGAAAGTGCAACAATT
GATGAGGAATTTGCTTCAAAACTTTCTACGGCTGCTAAAGAAAAATTCTACCACCAAGTT
GCTTCTACAGCTGAAACAGGATGGGATTTTAGCTCTCGATGGATGAGGGATTCTACTGAC
ATGACAACTCTGACAACATCTTGCATAATACCTGTGGACTTGAACACATTCATATTGAAG
ATGGAACAGGACATAGCTTTCTTTGCTAAACTCATTGGAGAGAGCACAACATCAGAAATA
TTTTCAGAGGCTTCAAAAGCACGCCATAATGCAATTGATTCTGTTCTGTGGAACGCTGAC
ATGGAGCAATGGCTTGACTACTGGCTTCCTACTGATGGAAACTGCCAGGGAGTCTACCAA
TGGAAATCTATCTCACAGAACCGCGCCATCTTTGCTTCTAATTTTGTACCTTTGTGGTTA
AATGCTCAACATTCAGGCTTGGAGCAATTTGTCGATGAGGCAAAATCAGTGAGAGTCATG
AGAAGCCTCCAGAAATCAGGATTACTGCAACCTGCAGGAATCGCAACTTCCTTATCAAAC
ACAGGGCAACAATGGGATTTTCCAAACGGATGGGCCCCGTTGCAGCATCTGATAGTCGAG
GGATTGTTGAGGTCTGGTTCAGGAGAGGCAAGGGAACTTGCTGAGGACATTGCCACGAGG
TGGGTGAGAACAAACTATGATGCCTATAAGGCTACCGGCGCGATGCATGAGAAGTACGAT
GTGGTGACCTGTGGAAAATCTGGAGGTGGGGGTGAATACAAACCCCAGACTGGTTTTGGT
TGGTCCAACGGTGTGATATTATCATTCTTGGATGAATTTGGATGGCCTCAGGACAAGAAG
ATAGACTGCTAG

Protein

564 aa

>Os10t0521000-01 Trehalase, Salt stress tolerance
MAPTAAVAGGGVEAEALLGLLQRVQSEALRAFGPNDFDPKLYVDLPLAADASAAAALASL
PRAAPSRGEMEAYISRYFALAGSDLVAAADPPDFERDPPGFLPRVERAEARAWALEVHAL
WKDLTRRVAPAVAARPDRHTLLPLPGRVVVPGSRFREVYYWDSYWVVRGLLVSKMYETAK
DIVLNLVYLVEKYGFVLNGARSYYTNRSQPPLLSSMVLDIYMATGDMAFVRRVFPSLLKE
HSFWMSEVHNVAVMDNHGRVHNLSRYQAMWNKPRPESATIDEEFASKLSTAAKEKFYHQV
ASTAETGWDFSSRWMRDSTDMTTLTTSCIIPVDLNTFILKMEQDIAFFAKLIGESTTSEI
FSEASKARHNAIDSVLWNADMEQWLDYWLPTDGNCQGVYQWKSISQNRAIFASNFVPLWL
NAQHSGLEQFVDEAKSVRVMRSLQKSGLLQPAGIATSLSNTGQQWDFPNGWAPLQHLIVE
GLLRSGSGEARELAEDIATRWVRTNYDAYKATGAMHEKYDVVTCGKSGGGGEYKPQTGFG
WSNGVILSFLDEFGWPQDKKIDC*

5'UTR

chr10:20159156..20159181 (- strand) : 26 bp

CDS

chr10:20158653..20159155 (- strand) : 503 bp

chr10:20157734..20157853 (- strand) : 120 bp

chr10:20157345..20157460 (- strand) : 116 bp

chr10:20157149..20157249 (- strand) : 101 bp

chr10:20156951..20157057 (- strand) : 107 bp

chr10:20156714..20156786 (- strand) : 73 bp

chr10:20156268..20156435 (- strand) : 168 bp

chr10:20156085..20156172 (- strand) : 88 bp

chr10:20155498..20155615 (- strand) : 118 bp

chr10:20155203..20155416 (- strand) : 214 bp

chr10:20154878..20154961 (- strand) : 84 bp

3'UTR

chr10:20154610..20154877 (- strand) : 268 bp

FASTA

>Os10t0521000-01 class=Sequence position=chr10:20154610..20159181 (- strand)
CTGTCCCCTT ACTCCGGCCG ATTCACATGG CGCCCACCGC CGCGGTTGCC GGGGGTGGCG TGGAGGCGGA GGCgctgctg
gggctgctgc agcgggtgca gtcggaggcg ctgcgggcgt tcgggccgaa cgacttcgac cccaagctct acgtcgacct
gccgctcgcc gccgacgcca gcgcggcggc cgcgctggcg tcgctgccgc gggcggcgcc gtcgaggggc gagatggAGG
CCTACATCTC GAGGTACTTC GCGCTGGCCG GGTCCGACCT CGTCgccgcc gccgacccgc cggacttcga gcgcgacccc
cccgggttcc tgcccagggt ggagcgcgcc gaggcgcggg cctgggcgct ggaggtgcac gcgctgtgga aggacctgac
gcggcgggtg gcgccggccg tcgcggcgcg ccccgaccgg cacacgctgc tgccgcTCCC CGGCAGGGTG GTCGTGCCGG
GCTCCAGGTT CCGGGAGGTC TACTACTGGG ACTCCTACTG GGTCGTCAGG TCCGTACCGT ACACCCTGCA TCTCCGCATC
CATCCATGAT TCCGTCCCGC TTTGCTCCAT TATTGGTCAT CACGAATGCG CTAGATCATC ACGTATGATT GATGAACATC
TTTGCGTGGA GAGGAATAAT TGATGAATCC AGGTTTCCAC CAATAGTGCA TAACATAGTA CACAACACGT GTTCTTGCAC
TTGTTGTCTT GTTAGGTATG GCCATTTCGG GGGAACATGC AAGTGTCGAA TCTCCAAAGG TTCACTTGTC TCTTTCTATG
GCACGACCTG CTGGATACTG GGGGCGGCTG AATATTCTAC AGGCAGTTGC GCTTTCCTGA CCGGCCTGGT TGTGCCCATG
GCCTATGGGG ATATATTTTA GCTTTCCAGA ATGAGGTTGT TGATTGACGC CGGCGTTGAC AAAGCTCAGG GTGATCTGTC
TTTAGATTTC TTAGGAAATT GCTGTGAGAG TTACCCCTCT ATCAAAAAAA AAATCAGATT CATCCCTAGG ATTTTTATTT
TTTTTTGGAT ATGACGTAGT TCTTTAAAAA AAAAAGGTTG TTGTCAGTAG CATTTTCATG GAAATGGCAA TGTAATAGTG
GCTCTCAGAG TGTCAGTAAA TACTGAAGAT CTTGGTTTCT AATTCAGTGG CTTCCACAGA AAATGATGCA GGTCTTGACT
TCATGCTTAC ATTTTTGCTA ATACCGTAGT ACCGTACAAG TGTACAGTAC GCGCTGATCA AATATGCCTC CCAGATAAAA
GTATTGATTT ACAATGTTTT TTCTTGTTTG CTATGTCATT GGATGCAGAG GTTTACTGGT GAGCAAAATG TATGAGACGG
CAAAGGATAT CGTGCTTAAT CTTGTGTATC TTGTTGAGAA ATATGGTTTT GTTCTGAACG GGGCAAGATC GTACTACACT
AACCGAAGGT GATAGCCTCT CTGCCATAGC ATACTGTTTG GTAAATATGG TCTGTACTCT GTGCTTTCAA CACAAAGTAG
TTCATTTTTG TCATGTTGTC TATCTGCTGC TAAGGAAGTA AATACATTTT TTTTATGTGA AGTTTAATGG ACCTTCATTA
ATTTTCCTTC ACCGAGAATT ACCTCCAGTC TTAATACTGC AAACTAAATA TATATAACTT AGAATGCAAT GTATTACTAT
ATGGTCCTTA TCTGAGACCT TGTCTTTGAC TCTTTGTGCA GCCAGCCACC ACTTTTAAGC TCCATGGTTT TAGACATATA
CATGGCAACT GGTGATATGG CTTTTGTGAG GAGGGTATTT CCCTCACTGC TGAAAGAGCA TAGTTTCTGG ATGTCAGGTA
ACAGATGACT GAAGCCACTT TACAGCATAT TTACAATTTT GCATGATTGA ACCAATCTCC CTATACAATG ATCCTGTCAT
GTACTCATGC AGAGGTTCAC AATGTGGCAG TAATGGACAA TCATGGACGG GTACATAATT TGAGTCGCTA CCAGGCTATG
TGGAACAAAC CTAGGCCAGA AAGTGCAACA ATTGTAAAGT TTTGATGATG TTCACGATGT TAACTTGCTG GTGGCAATGG
CAGCTTCTCA AGGATTAACT AACTATGGTC TGTTCTGAAT TTAGGATGAG GAATTTGCTT CAAAACTTTC TACGGCTGCT
AAAGAAAAAT TCTACCACCA AGTTGCTTCT ACAGCTGAAA CAGGATGGGA TTTTAGCTCT CGATGGATGA GGTTGGATGT
AAAAAACTTG TTATTACCGA TAGAAATGTA TTTGTTTGAC TGTTAATTAG TTAACGTGCA CAGTACTAAA GAAGACATTA
TGAGCTCCAA TGATATCAAA TTCACTGTTG TGATGCCACA TGCTGATTTC AGTTTTTCTT TAACTGCTTA TCCAGGGATT
CTACTGACAT GACAACTCTG ACAACATCTT GCATAATACC TGTGGACTTG AACACATTCA TATTGAAGGT ATGACATATA
GCGTGTCACG ATATTTGATT TCCAAACATG CATGACATAC AGATTCAGCA AAGTATGGAG TTTGTCATGA TATTCGAATT
CTGAACACAT AGTTTATAGA TTCAGCATGA TTTGTATGCA TCAGGTTTAG AATGCTTTGT AGTTCGCTTA TTCAATATTA
ATGTGCCCAT AATAGCTAGA GATGCTTGTT GGGAAAAATA TCCTTAATTG GTAAAGTCAA CAATGCTCAG AAATTTGACA
TGGTCCTCAC TTTGTACACA ACTCAGATGG AACAGGACAT AGCTTTCTTT GCTAAACTCA TTGGAGAGAG CACAACATCA
GAAATATTTT CAGAGGCTTC AAAAGCACGC CATAATGCAA TTGATTCTGT TCTGTGGAAC GCTGACATGG AGCAATGGCT
TGACTACTGG CTTCCTACTG ATGGAAACTG CCAGGTTTTC CCAATTGATA TCTGTTGATC TCCTATATTC TTTTCCATTT
GTGCAAGCAA CCTTGATTTT ATTAACTTGA TGACACTACT ATTTTACAGG GAGTCTACCA ATGGAAATCT ATCTCACAGA
ACCGCGCCAT CTTTGCTTCT AATTTTGTAC CTTTGTGGTT AAATGCTCAA CATTCAGGTT TGTCCTGTAG ACCCCCCATC
CTTGTGCTTA TCTTCTAATG CCAGGGTGTA ATGCTTTATT CTGGGAATAT CTAAAACTAC ACGGTAGTAT CTGTCTACAT
ATTTTTCATG AGTTGGCTGC CTTGTCCTGA ATTTCCTTTT ATGAGGTCTA GTACGAGTAT CCCATGAAAT TTTAACCACC
AAATGGCTAG AAACTGAACA GTTAATGCAG ACAAATCTTA TAGAAAGTAT CTAACACGTT TGTCTCTGTA TCATGCTCAT
ACTTCATGAT GTGCGTCGGT CTGTCATTTA TCTTACAACT TGCTTTCTTC ATTACATGTT TATAACTGCT GGAGCTGTTC
TTAGTAGTTA GTATTATAAC TCTAGTGATC ACATCACAGC TCTTACTCTT TTTTAAAAAA ATAAAAAAAA ATCTTTCACC
CTTTTCTTGC ATAGTTACTG AATAATATTG TCTGAAACAT AATTAGGCTT GGAGCAATTT GTCGATGAGG CAAAATCAGT
GAGAGTCATG AGAAGCCTCC AGAAATCAGG ATTACTGCAA CCTGCAGGAA TCGCAACTTC CTTATCAAAC ACAGGGCAAC
AATGGTCAGT TCACTGGAAG AGCATTCTCT CCCTGAAACC ATGTGGTTTC CTTCGCTTAA ACAGGTTTCC TCTATTTTTG
AACAGGGATT TTCCAAACGG ATGGGCCCCG TTGCAGCATC TGATAGTCGA GGGATTGTTG AGGTCTGGTT CAGGAGAGGC
AAGGGAACTT GCTGAGGACA TTGCCACGAG GTGGGTGAGA ACAAACTATG ATGCCTATAA GGCTACCGGC GCGATGCATG
AGAAGTACGA TGTGGTGACC TGTGGAAAAT CTGGAGGTGG GGGTGAATAC AAACCCCAGG TATGGTTGTT TTCTTCTAAA
TTCAAGTAAA AATCCTTCCT GTGTTGTGCT CACGCATCAA TAGAACATCT CTGTACAGTT CTGTACTCAT GTTGTGACTC
ACAACATGAG TACAGAATTA CTCATGTTGT GACTCCCTTT TCCTCTCATA CAATGATTAC GACACCAATA AAAGCAGAAA
CCGTGATCTC TTACCCTGCC TTTTCTTCTA ATTTGAGCTG TTGAACATCT CTATTCGCAG ACTGGTTTTG GTTGGTCCAA
CGGTGTGATA TTATCATTCT TGGATGAATT TGGATGGCCT CAGGACAAGA AGATAGACTG CTAGTCATCA TGATGAATGT
TAAACCCCAT CTTCGCAGAT GCAGAATGTG GCTAGGCTAG GCAGGTGTTT TTGTGTGCAA CTGTATATAC ACGGCTGTGC
ATTACACGCA AAGTTGAAGA GGCATTCTGC AATTCTGCTG TAGTTTTTAT CTGACAAACA TTTGCATTCA GATTTCAGAG
CATCACCCGC AACTGTGTTT TTTTTTCTTT TTTTGTAACT TGCCCTTTGC TGTAACTCGT ATCAAAGCTC AAAGCAAGAA
GAATCTTCAT GT