Os10t0527601-00

Locus

Os10g0527601

Description

Glutathione S-transferase, C-terminal-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GSTU20

CGSNL Gene Name

TAU GLUTATHIONE S-TRANSFERASE 20

Oryzabase Gene Symbol Synonym(s)

OsGSTU20

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

Q6WSC2 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Thioredoxin-like fold (IPR012336)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Expression Databases

TENOR (Os10t0527601-00)

Others

Oryzabase (9537)

Transcript

774 bp

>Os10t0527601-00 Glutathione S-transferase, C-terminal-like domain containing protein.
ATGGCCGGAGGAGGAGATGacctgaagatgctcggcgtctacgtgagcccattcccactg
cgagtgaagctcgcgctcagcttcaagggcctgagcttcgagtacgtcgaggaggacctc
cacaacaagagcgatctcctcgtcagctccaacccggtgcacaagaggacccccgtggtc
atccacaacggcaagcccatctccgagtccatggtcatcgtgcagtacctcgacgaggcg
ttccccggcgccggcgccgccctcctcccctccgaccccctcgaccgcgccgtcgctcgc
ttctgggcctcctacgtcgacgacaaggtaattcgtatgatcaccgtacatcagttctct
cacgcaagcttttctgacgattttggtgctgatcgaatgatgcagctgttcagtgcgtgg
aagatggtgttcaagggaaagacggaggaggagaaggtggaggggaggaagcagacgttc
gcggtggcggagacgctggagggagccctgagggagtgctccaaggggaagcccttcttt
ggcggcgacgccgtcgggtacgtcgacgtcgcGCTCGGTGGCTTCGTCCCGTGGGTGCAT
GCGATGGAGGAGCTGTTCGGGTTGAAGCAGTTCGACGCCGCCAAGACACCGCTCCTGGCG
GCGTGGCTGGAGCGCGTCGGCGAGCTCGAGGCCTACAAGGCGGTCATGCCGGACGCCGGC
ATGATGATAGAGTTCAAGAAGAAGCAGGCACAAGAAGCCGCCGCAGAGGCCTGA

CDS

774 bp

>Os10t0527601-00 Glutathione S-transferase, C-terminal-like domain containing protein.
ATGGCCGGAGGAGGAGATGacctgaagatgctcggcgtctacgtgagcccattcccactg
cgagtgaagctcgcgctcagcttcaagggcctgagcttcgagtacgtcgaggaggacctc
cacaacaagagcgatctcctcgtcagctccaacccggtgcacaagaggacccccgtggtc
atccacaacggcaagcccatctccgagtccatggtcatcgtgcagtacctcgacgaggcg
ttccccggcgccggcgccgccctcctcccctccgaccccctcgaccgcgccgtcgctcgc
ttctgggcctcctacgtcgacgacaaggtaattcgtatgatcaccgtacatcagttctct
cacgcaagcttttctgacgattttggtgctgatcgaatgatgcagctgttcagtgcgtgg
aagatggtgttcaagggaaagacggaggaggagaaggtggaggggaggaagcagacgttc
gcggtggcggagacgctggagggagccctgagggagtgctccaaggggaagcccttcttt
ggcggcgacgccgtcgggtacgtcgacgtcgcGCTCGGTGGCTTCGTCCCGTGGGTGCAT
GCGATGGAGGAGCTGTTCGGGTTGAAGCAGTTCGACGCCGCCAAGACACCGCTCCTGGCG
GCGTGGCTGGAGCGCGTCGGCGAGCTCGAGGCCTACAAGGCGGTCATGCCGGACGCCGGC
ATGATGATAGAGTTCAAGAAGAAGCAGGCACAAGAAGCCGCCGCAGAGGCCTGA

Protein

258 aa

>Os10t0527601-00 Glutathione S-transferase, C-terminal-like domain containing protein.
MAGGGDDLKMLGVYVSPFPLRVKLALSFKGLSFEYVEEDLHNKSDLLVSSNPVHKRTPVV
IHNGKPISESMVIVQYLDEAFPGAGAALLPSDPLDRAVARFWASYVDDKVIRMITVHQFS
HASFSDDFGADRMMQLFSAWKMVFKGKTEEEKVEGRKQTFAVAETLEGALRECSKGKPFF
GGDAVGYVDVALGGFVPWVHAMEELFGLKQFDAAKTPLLAAWLERVGELEAYKAVMPDAG
MMIEFKKKQAQEAAAEA*

CDS

chr10:20493427..20494200 (+ strand) : 774 bp

FASTA

>Os10t0527601-00 class=Sequence position=chr10:20493427..20494200 (+ strand)
ATGGCCGGAG GAGGAGATGa cctgaagatg ctcggcgtct acgtgagccc attcccactg cgagtgaagc tcgcgctcag
cttcaagggc ctgagcttcg agtacgtcga ggaggacctc cacaacaaga gcgatctcct cgtcagctcc aacccggtgc
acaagaggac ccccgtggtc atccacaacg gcaagcccat ctccgagtcc atggtcatcg tgcagtacct cgacgaggcg
ttccccggcg ccggcgccgc cctcctcccc tccgaccccc tcgaccgcgc cgtcgctcgc ttctgggcct cctacgtcga
cgacaaggta attcgtatga tcaccgtaca tcagttctct cacgcaagct tttctgacga ttttggtgct gatcgaatga
tgcagctgtt cagtgcgtgg aagatggtgt tcaagggaaa gacggaggag gagaaggtgg aggggaggaa gcagacgttc
gcggtggcgg agacgctgga gggagccctg agggagtgct ccaaggggaa gcccttcttt ggcggcgacg ccgtcgggta
cgtcgacgtc gcGCTCGGTG GCTTCGTCCC GTGGGTGCAT GCGATGGAGG AGCTGTTCGG GTTGAAGCAG TTCGACGCCG
CCAAGACACC GCTCCTGGCG GCGTGGCTGG AGCGCGTCGG CGAGCTCGAG GCCTACAAGG CGGTCATGCC GGACGCCGGC
ATGATGATAG AGTTCAAGAA GAAGCAGGCA CAAGAAGCCG CCGCAGAGGC CTGA

Locus: Os10g0527601

Loading...

Locus: Os10g0527601

Loading...