Os10t0535900-00

Locus

Os10g0535900

Description

Similar to ATEXPA7 (ARABIDOPSIS THALIANA EXPANSIN A7).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK372378 (DDBJ)

Protein Evidence

XP_002889941.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: plant-type cell wall organization (GO:0009664)

Cellular Component: extracellular region (GO:0005576)

Functional domain (InterPro)

Expansin (IPR002963)

Expansin/pollen allergen, DPBB domain (IPR007112)

Pollen allergen/expansin, C-terminal (IPR007117)

Expansin/Lol pI (IPR007118)

Barwin-related endoglucanase (IPR009009)

Barwin-like endoglucanase (IPR014733)

Expression Databases

TENOR (Os10t0535900-00)

Transcript

941 bp

>Os10t0535900-00 Similar to ATEXPA7 (ARABIDOPSIS THALIANA EXPANSIN A7).
AGAAGACCACGAGCAGGACAAGATCGGTGCAATGGCGGCGGCTTCATCGACGACGGCGAC
GACGGCCATCCTGGCGGCAGTGATCATCTCTCTCGCCGGCGCTGCCACCACCGTGGACGC
CAAGTTCAGGGCGATGCAGTGGACTCCCGCCCACGCCACGTTCTACGGCGACGAGACGGC
GTCGGAGACGATGGGTGGGGCGTGCGGGTACGGCAACCTGTACGCGAGCGGGTACGGGAC
GGACACGGCGGCGCTGAGCACGACGCTGTTCAAGGACGGCTACGGGTGCGGGACGTGCTA
CCAGATGCGGTGCGTGGGGACGGCGTCCTGCTACAGGGGCTCGCCGGCGATCACCGTGAC
GGCGACCAACCTGTGCCCGCCCAACTGGGCGGAGGACCCCGACCGCGGCGGCGGCGGCTG
GTGCAACCCGCCGCGGGCGCACTTTGACCTCTCCAAGCCGGCGTTCATGCGGATGGCCGA
CTGGCGCGCCGGCATCGTCCCCGTCATGTACCGCCGCGTGCCGTGCGCCCGCGCCGGCGG
CCTGCGGTTCGCGCTGCAGGGGAACCCGTACTGGCTGCTGGCCTACGTCATGAACGTCGC
CGGCGCCGGCGACGTCGGGGACATGTGGGTGAAGGCCGGCGGCGGCGGGGGTTGGGTGCG
GATGAGCCACAACTGGGGCGCGTCGTACCAGGCGTTCGCGCAGCTCGGCGGCCAGGCGCT
CAGCTTCAAGGTCACCTCCTACACCACCGGCCAGACCATCCTGGCCGCCGGCGTCACGCC
GGCGAGCTGGTGCTTCGGGCTCACGTACCAGGCCCGCGTGAACTTCTCCTAGATCGTTTT
TTTAGTAGCAGCAAGCAGCGAGGAGAACTCACTCTTGATAAGTGAGAATGCTCGGCTCTG
CTGCTCTCTTCTATCGTCTGCTCTGTCGCTGTATCGTAGTT

CDS

801 bp

>Os10t0535900-00 Similar to ATEXPA7 (ARABIDOPSIS THALIANA EXPANSIN A7).
ATGGCGGCGGCTTCATCGACGACGGCGACGACGGCCATCCTGGCGGCAGTGATCATCTCT
CTCGCCGGCGCTGCCACCACCGTGGACGCCAAGTTCAGGGCGATGCAGTGGACTCCCGCC
CACGCCACGTTCTACGGCGACGAGACGGCGTCGGAGACGATGGGTGGGGCGTGCGGGTAC
GGCAACCTGTACGCGAGCGGGTACGGGACGGACACGGCGGCGCTGAGCACGACGCTGTTC
AAGGACGGCTACGGGTGCGGGACGTGCTACCAGATGCGGTGCGTGGGGACGGCGTCCTGC
TACAGGGGCTCGCCGGCGATCACCGTGACGGCGACCAACCTGTGCCCGCCCAACTGGGCG
GAGGACCCCGACCGCGGCGGCGGCGGCTGGTGCAACCCGCCGCGGGCGCACTTTGACCTC
TCCAAGCCGGCGTTCATGCGGATGGCCGACTGGCGCGCCGGCATCGTCCCCGTCATGTAC
CGCCGCGTGCCGTGCGCCCGCGCCGGCGGCCTGCGGTTCGCGCTGCAGGGGAACCCGTAC
TGGCTGCTGGCCTACGTCATGAACGTCGCCGGCGCCGGCGACGTCGGGGACATGTGGGTG
AAGGCCGGCGGCGGCGGGGGTTGGGTGCGGATGAGCCACAACTGGGGCGCGTCGTACCAG
GCGTTCGCGCAGCTCGGCGGCCAGGCGCTCAGCTTCAAGGTCACCTCCTACACCACCGGC
CAGACCATCCTGGCCGCCGGCGTCACGCCGGCGAGCTGGTGCTTCGGGCTCACGTACCAG
GCCCGCGTGAACTTCTCCTAG

Protein

267 aa

>Os10t0535900-00 Similar to ATEXPA7 (ARABIDOPSIS THALIANA EXPANSIN A7).
MAAASSTTATTAILAAVIISLAGAATTVDAKFRAMQWTPAHATFYGDETASETMGGACGY
GNLYASGYGTDTAALSTTLFKDGYGCGTCYQMRCVGTASCYRGSPAITVTATNLCPPNWA
EDPDRGGGGWCNPPRAHFDLSKPAFMRMADWRAGIVPVMYRRVPCARAGGLRFALQGNPY
WLLAYVMNVAGAGDVGDMWVKAGGGGGWVRMSHNWGASYQAFAQLGGQALSFKVTSYTTG
QTILAAGVTPASWCFGLTYQARVNFS*

5'UTR

chr10:20846252..20846282 (+ strand) : 31 bp

CDS

chr10:20846283..20846445 (+ strand) : 163 bp

chr10:20846870..20847507 (+ strand) : 638 bp

3'UTR

chr10:20847508..20847616 (+ strand) : 109 bp

FASTA

>Os10t0535900-00 class=Sequence position=chr10:20846252..20847616 (+ strand)
AGAAGACCAC GAGCAGGACA AGATCGGTGC AATGGCGGCG GCTTCATCGA CGACGGCGAC GACGGCCATC CTGGCGGCAG
TGATCATCTC TCTCGCCGGC GCTGCCACCA CCGTGGACGC CAAGTTCAGG GCGATGCAGT GGACTCCCGC CCACGCCACG
TTCTACGGCG ACGAGACGGC GTCGGAGACG ATGGGTACGT ACACTCGTCg gattatttgc cccacgcctt aaaatacatt
ttttgtaaaa aaaaaatctt gcttTAAGCt actctcttcg ttataaatta taaatcgttt tgactttgat caaattaaat
tgcttcaaat ttaaccaagt ttataaaaaa aataacatat tcaacactag ataaatctat cataaaaata tattcaatta
taaattcaat gtaactaatt tgatgttgca gatgttataa atttacaata gtttaacttt gaccaaaatc aaaacgattt
gtaataCAGA ATGAATGTAA TATTTGTTAA ATTTTCATAG GGATGAGTCC ATGCGTGTTC TAGAAACAAT AATTTATATA
AATAATCATG TAATAAGTAC ATTAGTGTAA TAATCTGTAC CAAATTGGGT TGTGGCAGGT GGGGCGTGCG GGTACGGCAA
CCTGTACGCG AGCGGGTACG GGACGGACAC GGCGGCGCTG AGCACGACGC TGTTCAAGGA CGGCTACGGG TGCGGGACGT
GCTACCAGAT GCGGTGCGTG GGGACGGCGT CCTGCTACAG GGGCTCGCCG GCGATCACCG TGACGGCGAC CAACCTGTGC
CCGCCCAACT GGGCGGAGGA CCCCGACCGC GGCGGCGGCG GCTGGTGCAA CCCGCCGCGG GCGCACTTTG ACCTCTCCAA
GCCGGCGTTC ATGCGGATGG CCGACTGGCG CGCCGGCATC GTCCCCGTCA TGTACCGCCG CGTGCCGTGC GCCCGCGCCG
GCGGCCTGCG GTTCGCGCTG CAGGGGAACC CGTACTGGCT GCTGGCCTAC GTCATGAACG TCGCCGGCGC CGGCGACGTC
GGGGACATGT GGGTGAAGGC CGGCGGCGGC GGGGGTTGGG TGCGGATGAG CCACAACTGG GGCGCGTCGT ACCAGGCGTT
CGCGCAGCTC GGCGGCCAGG CGCTCAGCTT CAAGGTCACC TCCTACACCA CCGGCCAGAC CATCCTGGCC GCCGGCGTCA
CGCCGGCGAG CTGGTGCTTC GGGCTCACGT ACCAGGCCCG CGTGAACTTC TCCTAGATCG TTTTTTTAGT AGCAGCAAGC
AGCGAGGAGA ACTCACTCTT GATAAGTGAG AATGCTCGGC TCTGCTGCTC TCTTCTATCG TCTGCTCTGT CGCTGTATCG
TAGTT