Os10t0536000-01

Locus

Os10g0536000

Description

SUMO conjugating enzyme, Carbohydrate metabolism, Response to drought stress

RAP-DB Gene Symbol Synonym(s)

OsSCE1

RAP-DB Gene Name Synonym(s)

SUMO-conjugating enzyme 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSce1, OsUBC1, UBC1, OsSCE1b, SCE1b, OsSCE1b.1, OsSCE1b.2

Oryzabase Gene Name Synonym(s)

SUMO-conjugating enzyme 1, Ubiquitin-conjugating enzyme 1, E2 SUMO conjugation enzyme 1b, SUMO conjugation enzyme 1b, E2 protein SCE1b

Transcript Evidence

AK121221

Protein Evidence

Q8W2X7

Literature

PMID: 31212102

Note

Manual Curation

June 20, 2019

Functional domain (InterPro)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme E2 (IPR000608)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023090H15 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0536000-01)

RiceXPro (AK121221)

Others

Oryzabase (13202)

KEGG (Os10t0536000-01 (EC:6.3.2.19))

Transcript

840 bp

>Os10t0536000-01 SUMO conjugating enzyme, Carbohydrate metabolism, Response to drought stress
GGAAATAATAATACAAGAGACCGAACGACTAGAGATTAGAGAAGGCGGTGCTTCTTCTTC
TTTTCCAGAGACTACCAAGCCCAAACCAGCAACCACCCGCCGCCGCCGCCATGTCGGGAG
GGATCGCACGCGGCCGCCTCGCGGAGGAGCGCAAGGCCTGGCGGAAGAACCACCCTCACG
GGTTCGTGGCGAAGCCGGAGACGATGGCCGACGGGTCGGCGAACCTCATGATCTGGCACT
GCACCATCCCCGGCAAGCAGGGGACCGATTGGGAAGGTGGGTACTACCCTCTTACCCTTC
ACTTCAGTGAGGACTATCCTAGCAAACCACCCAAGTGCAAGTTCCCACAGGGCTTTTTCC
ACCCAAATGTCTATCCTTCAGGAACAGTGTGCCTCTCAATTCTTAATGAGGATAGTGGCT
GGAGACCTGCTATCACTGTAAAGCAGATCCTTGTTGGAATACAGGACTTGCTTGATCAGC
CAAATCCTGCTGATCCTGCACAGACTGACGGTTATCACATTTTTATACAGGACAAACCAG
AATATAAGAGGCGTGTTCGTGTTCAGGCCAAGCAGTACCCTGCTTTGCTTTGAGGACATT
GGCCTAATAAAGTTACTACCCGATTCATCATGCACATCCGCATAGTAGTTTGCAAAATCT
CAGATTATTGCACCAGAAAATATCGGATTTTATGGGATATAACCTAAAATGGAATGTTTG
AAGAACTGTCCAATATCATTGTGGACTTTTTGTGCTGTCATTACCATTTGTGCTGTGTGA
AGAACAGAAATAGCTTTGTCAACTGTTGAAACCGCTTGAGTGATGGATGCTAATTTGGAT

CDS

483 bp

>Os10t0536000-01 SUMO conjugating enzyme, Carbohydrate metabolism, Response to drought stress
ATGTCGGGAGGGATCGCACGCGGCCGCCTCGCGGAGGAGCGCAAGGCCTGGCGGAAGAAC
CACCCTCACGGGTTCGTGGCGAAGCCGGAGACGATGGCCGACGGGTCGGCGAACCTCATG
ATCTGGCACTGCACCATCCCCGGCAAGCAGGGGACCGATTGGGAAGGTGGGTACTACCCT
CTTACCCTTCACTTCAGTGAGGACTATCCTAGCAAACCACCCAAGTGCAAGTTCCCACAG
GGCTTTTTCCACCCAAATGTCTATCCTTCAGGAACAGTGTGCCTCTCAATTCTTAATGAG
GATAGTGGCTGGAGACCTGCTATCACTGTAAAGCAGATCCTTGTTGGAATACAGGACTTG
CTTGATCAGCCAAATCCTGCTGATCCTGCACAGACTGACGGTTATCACATTTTTATACAG
GACAAACCAGAATATAAGAGGCGTGTTCGTGTTCAGGCCAAGCAGTACCCTGCTTTGCTT
TGA

Protein

161 aa

>Os10t0536000-01 SUMO conjugating enzyme, Carbohydrate metabolism, Response to drought stress
MSGGIARGRLAEERKAWRKNHPHGFVAKPETMADGSANLMIWHCTIPGKQGTDWEGGYYP
LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
LDQPNPADPAQTDGYHIFIQDKPEYKRRVRVQAKQYPALL*

5'UTR

chr10:20851210..20851319 (- strand) : 110 bp

CDS

chr10:20851141..20851209 (- strand) : 69 bp

chr10:20850964..20851047 (- strand) : 84 bp

chr10:20848639..20848791 (- strand) : 153 bp

chr10:20848450..20848563 (- strand) : 114 bp

chr10:20848301..20848363 (- strand) : 63 bp

3'UTR

chr10:20848054..20848300 (- strand) : 247 bp

FASTA

>Os10t0536000-01 class=Sequence position=chr10:20848054..20851319 (- strand)
GGAAATAATA ATACAAGAGA CCGAACGACT AGAGATTAGA GAAGGCGGTG CTTCTTCTTC TTTTCCAGAG ACTACCAAGC
CCAAACCAGC AACCACCCGC CGCCGCCGCC ATGTCGGGAG GGATCGCACG CGGCCGCCTC GCGGAGGAGC GCAAGGCCTG
GCGGAAGAAC CACCCTCACG TCGGTGATTT TTTTTCTATT TTTTTCGCAT CTTCTATGGC CGCCGATTGT GTTTCTTCTG
ACCTGGTGCT TTGCTTGCTT GCTCTGGATC AGGGGTTCGT GGCGAAGCCG GAGACGATGG CCGACGGGTC GGCGAACCTC
ATGATCTGGC ACTGCACCAT CCCCGGCAAG CAGGGGGTAA GTAACCAAAC TGCTCTAGCC GAGGCGCCGA CGGCGAACCA
TCCCACCCCT CTTCCTGTTT CGATCTGTTT CGATTATGCT GCTGCGGATG CTGGTGTGTG CTCGGATTGT GATGCGACCA
CGCAATCGGA TGCTTCCTCT GTGTGGGGGA GAATTTAGGT TTTTGCCGCG CTGTTCTGTT GGTAGGTTTG GGAGGGGGGG
GGGGGTAGAT TTGTAGATTG GATTGGTATC TGCACTGGAA TCTCTATAAC CTGTGGGAGA ATTATGAGTA GTTATGTTGG
TTGGAGGGTT TGAATGAAGT TTTTATTGAT GGATCGTGTT GATTTGCAGT GGGGATTTGC TAGGGTCTTA CAGATCTTAG
TATGATTTTT TTTTTTAGAA TTTTAGTGTT ATCATCAATT GATCTAGTAG TACCTTTTAT TTCTGGACAG CTGGGAGGAG
TTTTCTCTGT TGTTTGAGTG TTAATTACGT GATTTTGTAG CATGAGTTGC CTTCAAACGT TCTAGGTTCA GCGTATCAAA
TAGTTCTTTT CCATCACTAG AGGTTTGCAC AGTTGCCTGC GTGCTTTGCT TTACCACCTG TAAACCAGGC ATGGAGCACA
CGGACTCATG AATCCCGATG CAATTGCACG GAGTCACGGG CACAGTTATT GAATTAACAG GGTACAAGGA TCTGAATGTT
GTAAGATTTA GTTGCTGAAA GATGGATTAT AGTCACCATC ACTACTGTCT TCATAATCAA CATCACTTCC AAAACACTTT
ATCTTGCATA TGGGGGGATA TATAGTAATC TTCAGTGGCG GACCCAGGAT TTCTTCATGC CCTAGGCCAA ATCTAATTGC
TACTATCCCA TACCATAAAT GAGACCCACA CTAATACATA ATAAGAAGTA CAATACAAAT TATTATAGTT TCGAAAGGAA
AAAAACAACA ACGCAAGAAA CAGCATctaa cctcaaaatg acagctattt gctctttgaa agatgcatct ccatcatact
catcaacaaa aatggcggat tttttttcca ccgaaagcat ttagaatggt tttacccgtc tcaattgcac aagatttaca
ctgtagattt tgtattttta gtgaagtgaa tagatgattc ccgggagaat TTTGAAATGT TTCTGGTCAT TAGATGATTC
CCGGGAGAAT TTTGAAATGT TTCTGGTCAT CTTTATTCTT CTCTTTATAC CCCATCAATC ATCTATAGAT TTCATCGCTA
AGCCTCTTCA CCTTCTATCT CTATTAAGTT TAAAACAAAT TGAATGGAAT CAGAAGATCT ATAGGTGATC TAGGCCATTT
AGGCATTTGA GAAATGGGAA TACCAGAAAT AGATTATGAA AAACTCACCT GTCAAGGTCC TCGTCCGCTC CTTGCCCGAC
AGAGTGGAGG TCTGAGACTC TGAGCACCTG CCGCTTGCCG CAGGCGCACC GTGCAGGGGG GTTGTGCAGA AAGAGCCTTG
TTGCCGGGCC GCCGAGCCAG CGAGAGGAGC TGAGGAGGCA GTGGACATGG ACGGAGGGAG GGAAGTGAGG TGGCTGGGCA
GGGTGGTGGG TGGCTGGAAG CGGGGAGACT CACGTATGGT GGCGGCTGGC CTTGGAGGGA GCGAGCAGGG AGGGAGGCGA
GGGGACGGAC GCATCGGCGT CGGCGCATCT CCCACGAGCG CATAGCGTTG TAGTGGTAGC AGGGGGAAGT TAGGGTTAGA
CAATAAATAG TATTGGGCAA TAGATGCTAG CCTGACGGGC CTCGGGCCAA ACCTTTGTGA GCCAAAATTT CTAAGCTGTA
ACCAATGGGG GGATCCATTG CTAGTTGGGC CAGGCCCCAG GTTGTGGCCT AAGGTGCCCG GGCCTGGGTG CGCCCCTGGT
GATCTTGTGT ATTAGTTCAG CATGCTGCTG CTCAACTTCT ATTGTTATGT AACAATCACT CTCTTGACAA ACCAGCCTAG
TAGGCTAACA AATACTAATT TTCCTTCAAT AAATGTATTA TTGTCATATA CTTATTGCTT CTTTATGTTG ATATATGTAT
ATTACAGTGT ATTTTTCACT CTGCCCATGG AACGCCAATT AGGGGTTGCT TTTAAGCTTT TCCTGTTTCT TTCCATCCAG
AGTTCATAAT TGCTTATGTT ATTTGTGTGT ATTGCTACAT TTGTACAGAC CGATTGGGAA GGTGGGTACT ACCCTCTTAC
CCTTCACTTC AGTGAGGACT ATCCTAGCAA ACCACCCAAG TGCAAGTTCC CACAGGGCTT TTTCCACCCA AATGTCTATC
CTTCAGGAAC AGTGTGCCTC TCAATTCTTA ATGAGGATAG TGTAAGTCTT CAAGCTGTTT CTTCAGTCTT ATTTATTTCC
AGTCTACCGA ATTTATTTAC AGTTGCATCT TCTCAGGGCT GGAGACCTGC TATCACTGTA AAGCAGATCC TTGTTGGAAT
ACAGGACTTG CTTGATCAGC CAAATCCTGC TGATCCTGCA CAGACTGACG GTTATCACAT TTTTATACAG GTCGGAATGA
AAAAAAAATG AGATTCTGGC ATTCCTTGTT CTTACATTAC ATGTCATTCA TTGACATTAT TTTGTCTACT TTGCAGGACA
AACCAGAATA TAAGAGGCGT GTTCGTGTTC AGGCCAAGCA GTACCCTGCT TTGCTTTGAG GACATTGGCC TAATAAAGTT
ACTACCCGAT TCATCATGCA CATCCGCATA GTAGTTTGCA AAATCTCAGA TTATTGCACC AGAAAATATC GGATTTTATG
GGATATAACC TAAAATGGAA TGTTTGAAGA ACTGTCCAAT ATCATTGTGG ACTTTTTGTG CTGTCATTAC CATTTGTGCT
GTGTGAAGAA CAGAAATAGC TTTGTCAACT GTTGAAACCG CTTGAGTGAT GGATGCTAAT TTGGAT

Locus: Os10g0536000

Loading...

Locus: Os10g0536000

Loading...