Os10t0536000-02

Locus

Os10g0536000

Description

Similar to SUMO E2 conjugating enzyme SCE1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSce1, OsUBC1, UBC1, OsSCE1b, SCE1b, OsSCE1b.1, OsSCE1b.2

Oryzabase Gene Name Synonym(s)

SUMO-conjugating enzyme 1, Ubiquitin-conjugating enzyme 1, E2 SUMO conjugation enzyme 1b, SUMO conjugation enzyme 1b, E2 protein SCE1b

Transcript Evidence

AK105227 (DDBJ, Best hit)

Protein Evidence

B8BI11 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

001-111-C09 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0536000-02)

Others

Oryzabase (13202)

Transcript

809 bp

>Os10t0536000-02 Similar to SUMO E2 conjugating enzyme SCE1.
GGCGGTGCTTCTTCTTCTTTTCCAGAGACTACCAAGCCCAAACCAGCAACCACCCGCCGC
CGCCGCCATGTCGGGAGGGATCGCACGCGGCCGCCTCGCGGAGGAGCGCAAGGCCTGGCG
GAAGAACCACCCTCACGGGTTCGTGGCGAAGCCGGAGACGATGGCCGACGGGTCGGCGAA
CCTCATGATCTGGCACTGCACCATCCCCGGCAAGCAGGGGACCGATTGGGAAGGTGGGTA
CTACCCTCTTACCCTTCACTTCAGTGAGGACTATCCTAGCAAACCACCCAAGTGCAAGTT
CCCACAGGGCTTTTTCCACCCAAATGTCTATCCTTCAGGAACAGTGTGCCTCTCAATTCT
TAATGAGGATAGTGGCTGGAGACCTGCTATCACTGTAAAGCAGATCCTTGTTGGAATACA
GGACTTGCTTGATCAGCCAAATCCTGCTGATCCTGCACAGACTGACGGTTATCACATTTT
TATACAGGACAAACCAGAATATAAGAGGCGTGTTCGTGTTCAGGCCAAGCAGTACCCTGC
TTTGCTTTGAGGACATTGGCCTAATAAAGTTACTACCCGATTCATCATGCACATCCGCAT
AGTAGTTTGCAAAATCTCAGATTATTGCACCAGAAAATATCGGATTTTATGGGATATAAC
CTAAAATGGAATGTTTGAAGAACTGTCCAATATCATTGTGGACTTTTTGTGCTGTCATTA
CCATTTGTGCTGTGTGAAGAACAGAAATAGCTTTGTCAACTGTTGAAACCGCTTGAGTGA
TGGATGCTAATTTGGATAACAAATGAACT

CDS

483 bp

>Os10t0536000-02 Similar to SUMO E2 conjugating enzyme SCE1.
ATGTCGGGAGGGATCGCACGCGGCCGCCTCGCGGAGGAGCGCAAGGCCTGGCGGAAGAAC
CACCCTCACGGGTTCGTGGCGAAGCCGGAGACGATGGCCGACGGGTCGGCGAACCTCATG
ATCTGGCACTGCACCATCCCCGGCAAGCAGGGGACCGATTGGGAAGGTGGGTACTACCCT
CTTACCCTTCACTTCAGTGAGGACTATCCTAGCAAACCACCCAAGTGCAAGTTCCCACAG
GGCTTTTTCCACCCAAATGTCTATCCTTCAGGAACAGTGTGCCTCTCAATTCTTAATGAG
GATAGTGGCTGGAGACCTGCTATCACTGTAAAGCAGATCCTTGTTGGAATACAGGACTTG
CTTGATCAGCCAAATCCTGCTGATCCTGCACAGACTGACGGTTATCACATTTTTATACAG
GACAAACCAGAATATAAGAGGCGTGTTCGTGTTCAGGCCAAGCAGTACCCTGCTTTGCTT
TGA

Protein

161 aa

>Os10t0536000-02 Similar to SUMO E2 conjugating enzyme SCE1.
MSGGIARGRLAEERKAWRKNHPHGFVAKPETMADGSANLMIWHCTIPGKQGTDWEGGYYP
LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
LDQPNPADPAQTDGYHIFIQDKPEYKRRVRVQAKQYPALL*

5'UTR

chr10:20851210..20851276 (- strand) : 67 bp

CDS

chr10:20851141..20851209 (- strand) : 69 bp

chr10:20850964..20851047 (- strand) : 84 bp

chr10:20848639..20848791 (- strand) : 153 bp

chr10:20848450..20848563 (- strand) : 114 bp

chr10:20848301..20848363 (- strand) : 63 bp

3'UTR

chr10:20848042..20848300 (- strand) : 259 bp

FASTA

>Os10t0536000-02 class=Sequence position=chr10:20848042..20851276 (- strand)
GGCGGTGCTT CTTCTTCTTT TCCAGAGACT ACCAAGCCCA AACCAGCAAC CACCCGCCGC CGCCGCCATG TCGGGAGGGA
TCGCACGCGG CCGCCTCGCG GAGGAGCGCA AGGCCTGGCG GAAGAACCAC CCTCACGTCG GTGATTTTTT TTCTATTTTT
TTCGCATCTT CTATGGCCGC CGATTGTGTT TCTTCTGACC TGGTGCTTTG CTTGCTTGCT CTGGATCAGG GGTTCGTGGC
GAAGCCGGAG ACGATGGCCG ACGGGTCGGC GAACCTCATG ATCTGGCACT GCACCATCCC CGGCAAGCAG GGGGTAAGTA
ACCAAACTGC TCTAGCCGAG GCGCCGACGG CGAACCATCC CACCCCTCTT CCTGTTTCGA TCTGTTTCGA TTATGCTGCT
GCGGATGCTG GTGTGTGCTC GGATTGTGAT GCGACCACGC AATCGGATGC TTCCTCTGTG TGGGGGAGAA TTTAGGTTTT
TGCCGCGCTG TTCTGTTGGT AGGTTTGGGA GGGGGGGGGG GGTAGATTTG TAGATTGGAT TGGTATCTGC ACTGGAATCT
CTATAACCTG TGGGAGAATT ATGAGTAGTT ATGTTGGTTG GAGGGTTTGA ATGAAGTTTT TATTGATGGA TCGTGTTGAT
TTGCAGTGGG GATTTGCTAG GGTCTTACAG ATCTTAGTAT GATTTTTTTT TTTAGAATTT TAGTGTTATC ATCAATTGAT
CTAGTAGTAC CTTTTATTTC TGGACAGCTG GGAGGAGTTT TCTCTGTTGT TTGAGTGTTA ATTACGTGAT TTTGTAGCAT
GAGTTGCCTT CAAACGTTCT AGGTTCAGCG TATCAAATAG TTCTTTTCCA TCACTAGAGG TTTGCACAGT TGCCTGCGTG
CTTTGCTTTA CCACCTGTAA ACCAGGCATG GAGCACACGG ACTCATGAAT CCCGATGCAA TTGCACGGAG TCACGGGCAC
AGTTATTGAA TTAACAGGGT ACAAGGATCT GAATGTTGTA AGATTTAGTT GCTGAAAGAT GGATTATAGT CACCATCACT
ACTGTCTTCA TAATCAACAT CACTTCCAAA ACACTTTATC TTGCATATGG GGGGATATAT AGTAATCTTC AGTGGCGGAC
CCAGGATTTC TTCATGCCCT AGGCCAAATC TAATTGCTAC TATCCCATAC CATAAATGAG ACCCACACTA ATACATAATA
AGAAGTACAA TACAAATTAT TATAGTTTCG AAAGGAAAAA AACAACAACG CAAGAAACAG CATctaacct caaaatgaca
gctatttgct ctttgaaaga tgcatctcca tcatactcat caacaaaaat ggcggatttt ttttccaccg aaagcattta
gaatggtttt acccgtctca attgcacaag atttacactg tagattttgt atttttagtg aagtgaatag atgattcccg
ggagaatTTT GAAATGTTTC TGGTCATTAG ATGATTCCCG GGAGAATTTT GAAATGTTTC TGGTCATCTT TATTCTTCTC
TTTATACCCC ATCAATCATC TATAGATTTC ATCGCTAAGC CTCTTCACCT TCTATCTCTA TTAAGTTTAA AACAAATTGA
ATGGAATCAG AAGATCTATA GGTGATCTAG GCCATTTAGG CATTTGAGAA ATGGGAATAC CAGAAATAGA TTATGAAAAA
CTCACCTGTC AAGGTCCTCG TCCGCTCCTT GCCCGACAGA GTGGAGGTCT GAGACTCTGA GCACCTGCCG CTTGCCGCAG
GCGCACCGTG CAGGGGGGTT GTGCAGAAAG AGCCTTGTTG CCGGGCCGCC GAGCCAGCGA GAGGAGCTGA GGAGGCAGTG
GACATGGACG GAGGGAGGGA AGTGAGGTGG CTGGGCAGGG TGGTGGGTGG CTGGAAGCGG GGAGACTCAC GTATGGTGGC
GGCTGGCCTT GGAGGGAGCG AGCAGGGAGG GAGGCGAGGG GACGGACGCA TCGGCGTCGG CGCATCTCCC ACGAGCGCAT
AGCGTTGTAG TGGTAGCAGG GGGAAGTTAG GGTTAGACAA TAAATAGTAT TGGGCAATAG ATGCTAGCCT GACGGGCCTC
GGGCCAAACC TTTGTGAGCC AAAATTTCTA AGCTGTAACC AATGGGGGGA TCCATTGCTA GTTGGGCCAG GCCCCAGGTT
GTGGCCTAAG GTGCCCGGGC CTGGGTGCGC CCCTGGTGAT CTTGTGTATT AGTTCAGCAT GCTGCTGCTC AACTTCTATT
GTTATGTAAC AATCACTCTC TTGACAAACC AGCCTAGTAG GCTAACAAAT ACTAATTTTC CTTCAATAAA TGTATTATTG
TCATATACTT ATTGCTTCTT TATGTTGATA TATGTATATT ACAGTGTATT TTTCACTCTG CCCATGGAAC GCCAATTAGG
GGTTGCTTTT AAGCTTTTCC TGTTTCTTTC CATCCAGAGT TCATAATTGC TTATGTTATT TGTGTGTATT GCTACATTTG
TACAGACCGA TTGGGAAGGT GGGTACTACC CTCTTACCCT TCACTTCAGT GAGGACTATC CTAGCAAACC ACCCAAGTGC
AAGTTCCCAC AGGGCTTTTT CCACCCAAAT GTCTATCCTT CAGGAACAGT GTGCCTCTCA ATTCTTAATG AGGATAGTGT
AAGTCTTCAA GCTGTTTCTT CAGTCTTATT TATTTCCAGT CTACCGAATT TATTTACAGT TGCATCTTCT CAGGGCTGGA
GACCTGCTAT CACTGTAAAG CAGATCCTTG TTGGAATACA GGACTTGCTT GATCAGCCAA ATCCTGCTGA TCCTGCACAG
ACTGACGGTT ATCACATTTT TATACAGGTC GGAATGAAAA AAAAATGAGA TTCTGGCATT CCTTGTTCTT ACATTACATG
TCATTCATTG ACATTATTTT GTCTACTTTG CAGGACAAAC CAGAATATAA GAGGCGTGTT CGTGTTCAGG CCAAGCAGTA
CCCTGCTTTG CTTTGAGGAC ATTGGCCTAA TAAAGTTACT ACCCGATTCA TCATGCACAT CCGCATAGTA GTTTGCAAAA
TCTCAGATTA TTGCACCAGA AAATATCGGA TTTTATGGGA TATAACCTAA AATGGAATGT TTGAAGAACT GTCCAATATC
ATTGTGGACT TTTTGTGCTG TCATTACCAT TTGTGCTGTG TGAAGAACAG AAATAGCTTT GTCAACTGTT GAAACCGCTT
GAGTGATGGA TGCTAATTTG GATAACAAAT GAACT

Locus: Os10g0536000

Loading...

Locus: Os10g0536000

Loading...