Os10t0537800-01

Locus

Os10g0537800

Description

Peptidase aspartic, catalytic domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK061277 (DDBJ, Best hit)

Protein Evidence

NP_001065177.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: aspartic-type endopeptidase activity (GO:0004190)

Functional domain (InterPro)

Peptidase A1 (IPR001461)

Peptidase aspartic, catalytic (IPR009007)

Peptidase aspartic (IPR021109)

Full-length cDNA

006-212-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0537800-01)

RiceXPro (AK061277)

Others

KEGG (Os10t0537800-01)

Transcript

1404 bp

>Os10t0537800-01 Peptidase aspartic, catalytic domain containing protein.
AATCAAGCATCAATCCCTCATTAGCATCGCTGGTTGATACTAAACTAACAGTAGCCATAA
TCATGGGAAGGCCAGTGGCAACGCTGCTGGTGCTGTGCTTCATCTCTGTCACGGCGCGCG
CCGCCGCGTTCCGCGTGCACGGCCGCCTCCTCGCCGACGCCGCGACGGAGGGAGGCGCCG
TCGTGCCCATCCACTGGACCCAGGCAATGAACTACGTCGCGAACTTCACCATCGGCACGC
CGCCGCAGCCGGCGTCGGCGGTCATCGACCTCGCCGGGGAGCTCGTCTGGACGCAGTGCA
AGCAGTGCGGCCGCTGCTTCGAGCAGGGCACGCCACTGTTCGACCCGACCGCGTCGAACA
CCTACCGGGCGGAGCCGTGCGGCACCCCGCTCTGCGAGTCCATCCCGAGCGACGTCCGCA
ACTGCTCCGGCAACGTGTGCGCGTACGAGGCGTCCACCAATGCCGGGGACACCGGCGGCA
AGGTCGGCACCGACACCTTCGCCGTCGGGACGGCCAAGGCGAGCCTCGCGTTCGGGTGCG
TCGTGGCGAGCGACATCGACACCATGGGCGGGCCTTCCGGGATCGTCGGGCTAGGGAGGA
CGCCGTGGTCGCTAGTCACCCAGACGGGCGTCGCCGCGTTCTCCTACTGCCTGGCGCCGC
ACGACGCCGGGAAGAACAGCGCGCTGTTCCTCGGCTCCTCCGCGAAGCTCGCCGGCGGCG
GCAAGGCCGCCTCGACGCCGTTCGTCAACATCTCCGGCAACGGCAATGACCTGAGCAACT
ACTACAAGGTCCAACTCGAAGGGCTGAAGGCCGGCGACGCGATGATCCCGCTGCCGCCGA
GCGGCAGCACCGTCCTGCTCGACACCTTCTCGCCGATCAGCTTCCTCGTCGACGGCGCTT
ACCAGGCCGTCAAGAAGGCGGTGACGGTCGCCGTCGGCGCACCGCCGATGGCGACGCCGG
TGGAGCCGTTCGACCTCTGCTTCCCGAAATCGGGGGCGAGCGGCGCGGCGCCGGACCTCG
TGTTCACGTTCCGGGGCGGCGCCGCCATGACGGTGCCGGCGACGAACTACCTGCTCGACT
ACAAGAACGGCACGGTGTGCCTCGCCATGCTGAGCTCGGCGCGGCTGAACTCGACGACGG
AGCTGAGCTTGCTGGGAAGCTTGCAGCAGGAGAACATCCATTTCCTCTTCGACCTCGACA
AGGAGACGCTCTCCTTCGAGCCTGCAGACTGCACTAAACTCTCCTAGCTAATCAATGGCT
GCTGCTACTTAATTACTTTCTTCATATGTATGTGTACTTCTGAATAACGCAGCCTTGCGG
CATGAGCTGCAGCATGCTCATGTTGGTGAAAATAATACTCCATTCTTATTATTATTCTGT
GGCGATCTGGCCTACTTCGATTTC

CDS

1185 bp

>Os10t0537800-01 Peptidase aspartic, catalytic domain containing protein.
ATGGGAAGGCCAGTGGCAACGCTGCTGGTGCTGTGCTTCATCTCTGTCACGGCGCGCGCC
GCCGCGTTCCGCGTGCACGGCCGCCTCCTCGCCGACGCCGCGACGGAGGGAGGCGCCGTC
GTGCCCATCCACTGGACCCAGGCAATGAACTACGTCGCGAACTTCACCATCGGCACGCCG
CCGCAGCCGGCGTCGGCGGTCATCGACCTCGCCGGGGAGCTCGTCTGGACGCAGTGCAAG
CAGTGCGGCCGCTGCTTCGAGCAGGGCACGCCACTGTTCGACCCGACCGCGTCGAACACC
TACCGGGCGGAGCCGTGCGGCACCCCGCTCTGCGAGTCCATCCCGAGCGACGTCCGCAAC
TGCTCCGGCAACGTGTGCGCGTACGAGGCGTCCACCAATGCCGGGGACACCGGCGGCAAG
GTCGGCACCGACACCTTCGCCGTCGGGACGGCCAAGGCGAGCCTCGCGTTCGGGTGCGTC
GTGGCGAGCGACATCGACACCATGGGCGGGCCTTCCGGGATCGTCGGGCTAGGGAGGACG
CCGTGGTCGCTAGTCACCCAGACGGGCGTCGCCGCGTTCTCCTACTGCCTGGCGCCGCAC
GACGCCGGGAAGAACAGCGCGCTGTTCCTCGGCTCCTCCGCGAAGCTCGCCGGCGGCGGC
AAGGCCGCCTCGACGCCGTTCGTCAACATCTCCGGCAACGGCAATGACCTGAGCAACTAC
TACAAGGTCCAACTCGAAGGGCTGAAGGCCGGCGACGCGATGATCCCGCTGCCGCCGAGC
GGCAGCACCGTCCTGCTCGACACCTTCTCGCCGATCAGCTTCCTCGTCGACGGCGCTTAC
CAGGCCGTCAAGAAGGCGGTGACGGTCGCCGTCGGCGCACCGCCGATGGCGACGCCGGTG
GAGCCGTTCGACCTCTGCTTCCCGAAATCGGGGGCGAGCGGCGCGGCGCCGGACCTCGTG
TTCACGTTCCGGGGCGGCGCCGCCATGACGGTGCCGGCGACGAACTACCTGCTCGACTAC
AAGAACGGCACGGTGTGCCTCGCCATGCTGAGCTCGGCGCGGCTGAACTCGACGACGGAG
CTGAGCTTGCTGGGAAGCTTGCAGCAGGAGAACATCCATTTCCTCTTCGACCTCGACAAG
GAGACGCTCTCCTTCGAGCCTGCAGACTGCACTAAACTCTCCTAG

Protein

395 aa

>Os10t0537800-01 Peptidase aspartic, catalytic domain containing protein.
MGRPVATLLVLCFISVTARAAAFRVHGRLLADAATEGGAVVPIHWTQAMNYVANFTIGTP
PQPASAVIDLAGELVWTQCKQCGRCFEQGTPLFDPTASNTYRAEPCGTPLCESIPSDVRN
CSGNVCAYEASTNAGDTGGKVGTDTFAVGTAKASLAFGCVVASDIDTMGGPSGIVGLGRT
PWSLVTQTGVAAFSYCLAPHDAGKNSALFLGSSAKLAGGGKAASTPFVNISGNGNDLSNY
YKVQLEGLKAGDAMIPLPPSGSTVLLDTFSPISFLVDGAYQAVKKAVTVAVGAPPMATPV
EPFDLCFPKSGASGAAPDLVFTFRGGAAMTVPATNYLLDYKNGTVCLAMLSSARLNSTTE
LSLLGSLQQENIHFLFDLDKETLSFEPADCTKLS*

5'UTR

chr10:20956884..20956945 (+ strand) : 62 bp

CDS

chr10:20956946..20958130 (+ strand) : 1185 bp

3'UTR

chr10:20958131..20958287 (+ strand) : 157 bp

FASTA

>Os10t0537800-01 class=Sequence position=chr10:20956884..20958287 (+ strand)
AATCAAGCAT CAATCCCTCA TTAGCATCGC TGGTTGATAC TAAACTAACA GTAGCCATAA TCATGGGAAG GCCAGTGGCA
ACGCTGCTGG TGCTGTGCTT CATCTCTGTC ACGGCGCGCG CCGCCGCGTT CCGCGTGCAC GGCCGCCTCC TCGCCGACGC
CGCGACGGAG GGAGGCGCCG TCGTGCCCAT CCACTGGACC CAGGCAATGA ACTACGTCGC GAACTTCACC ATCGGCACGC
CGCCGCAGCC GGCGTCGGCG GTCATCGACC TCGCCGGGGA GCTCGTCTGG ACGCAGTGCA AGCAGTGCGG CCGCTGCTTC
GAGCAGGGCA CGCCACTGTT CGACCCGACC GCGTCGAACA CCTACCGGGC GGAGCCGTGC GGCACCCCGC TCTGCGAGTC
CATCCCGAGC GACGTCCGCA ACTGCTCCGG CAACGTGTGC GCGTACGAGG CGTCCACCAA TGCCGGGGAC ACCGGCGGCA
AGGTCGGCAC CGACACCTTC GCCGTCGGGA CGGCCAAGGC GAGCCTCGCG TTCGGGTGCG TCGTGGCGAG CGACATCGAC
ACCATGGGCG GGCCTTCCGG GATCGTCGGG CTAGGGAGGA CGCCGTGGTC GCTAGTCACC CAGACGGGCG TCGCCGCGTT
CTCCTACTGC CTGGCGCCGC ACGACGCCGG GAAGAACAGC GCGCTGTTCC TCGGCTCCTC CGCGAAGCTC GCCGGCGGCG
GCAAGGCCGC CTCGACGCCG TTCGTCAACA TCTCCGGCAA CGGCAATGAC CTGAGCAACT ACTACAAGGT CCAACTCGAA
GGGCTGAAGG CCGGCGACGC GATGATCCCG CTGCCGCCGA GCGGCAGCAC CGTCCTGCTC GACACCTTCT CGCCGATCAG
CTTCCTCGTC GACGGCGCTT ACCAGGCCGT CAAGAAGGCG GTGACGGTCG CCGTCGGCGC ACCGCCGATG GCGACGCCGG
TGGAGCCGTT CGACCTCTGC TTCCCGAAAT CGGGGGCGAG CGGCGCGGCG CCGGACCTCG TGTTCACGTT CCGGGGCGGC
GCCGCCATGA CGGTGCCGGC GACGAACTAC CTGCTCGACT ACAAGAACGG CACGGTGTGC CTCGCCATGC TGAGCTCGGC
GCGGCTGAAC TCGACGACGG AGCTGAGCTT GCTGGGAAGC TTGCAGCAGG AGAACATCCA TTTCCTCTTC GACCTCGACA
AGGAGACGCT CTCCTTCGAG CCTGCAGACT GCACTAAACT CTCCTAGCTA ATCAATGGCT GCTGCTACTT AATTACTTTC
TTCATATGTA TGTGTACTTC TGAATAACGC AGCCTTGCGG CATGAGCTGC AGCATGCTCA TGTTGGTGAA AATAATACTC
CATTCTTATT ATTATTCTGT GGCGATCTGG CCTACTTCGA TTTC

Locus: Os10g0537800

Loading...

Locus: Os10g0537800

Loading...