Os10t0550300-00

Locus

Os10g0550300

Description

Rop nucleotide exchanger, PRONE domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ROPGEF1

CGSNL Gene Name

ROP-SPECIFIC GUANINE NUCLEOTIDE EXCHANGE FACTOR 1

Oryzabase Gene Symbol Synonym(s)

Os RopGEF1, OsRopGEF1, RopGEF1

Oryzabase Gene Name Synonym(s)

guanine nucleotide exchange factor for Rop 1, Rop-specific GEF1, Rop-specific guanine nucleotide exchange factor 1

Transcript Evidence

BT033836 (DDBJ)

Protein Evidence

B4F9P8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: Rho guanyl-nucleotide exchange factor activity (GO:0005089)

Functional domain (InterPro)

Plant specific Rop nucleotide exchanger, PRONE (IPR005512)

Expression Databases

TENOR (Os10t0550300-00)

Others

Oryzabase (11443)

KEGG (Os10t0550300-00)

Transcript

1633 bp

>Os10t0550300-00 Rop nucleotide exchanger, PRONE domain containing protein.
ATGGAGAGTAGCTCGTCGGTGTCGGTGTCCGACGAGAGCTCGGAGGCGAACGGCGGCGGG
TGCTGCTCGTCGTCGACGACGCCGAGCATGGACGCGGTGAACCTGAGCCGGACTTTCTCC
GACGTGTCGTCCTTCTCGGAGGAGCATGGCGGCAGCGGCAGCAGCGTCGACCACAGTGGC
CCGTTCGAGCCGCCGTCCGCCGCCGCCGTGTCGAGGCTGATCGGccgccgctcgccggct
gcggcggcctccgctctcagcctcagccgcctcagcatgaagccccgggccgacgtgctc
gaccggcgctccaccgacgacgagctggagctcgtcaaggagaggttctccaagctcctg
ctcggcgaggacatgtccggcggcggcaagggcgtctgcaccgccgtcgccatctccaac
gccatcaccaaCCTCTACGCCACGGTGTTCGGGAGTTGCCACAAGCTGGAGCCATTGCCG
GCGGGGAAGAAGACGATGTGGAGGAGGGAGATGGACTGCCTCCTCTCCGTATGCGACTAC
ATCGTCGAGTTCTACCCCTCCTCACAGACTCTCCCCGATGGCACCAAAGTCGAGGTCATG
GCCACCAGGCCAAGATCCGACATCTACATCAACCTCCCTGCTCTGGAGAAGCTCGATGCC
ATGCTCATTGAGATACTGGAGAGTTTTCAGAAGGCGGAGTTCTGGTACGCGGACGCCGGG
ACGAGGTCGTTCGGGTCGGCGACGTCGTCGTCGACGATGTCGTCGTCGTCGTTCCGGCGG
TCGACGCACCGGAACGAGGACAGGTGGTGGCTGCCGGTGCCGTGCGTCCCCGACGGCGGC
ATCTCCGGCAAGGCCCGCAAGGAGCTCCAGCAGAAGCGCGACTGCGCCACCCAGATCCAC
AAGGCCGCCGTCGCCATCAACACCGGCGTCCTCGGCGACATGGAGGTCCCCGACTCCTTC
ATGGCCATCCTCCCCAAGAGTGGGAaggcgagcgtgggggacggggtgtacagggcgatg
ctgggggcggagaagttctcgccggagtacctgctggactgcctggacatgtcgtcggag
cacgaggcgctggcgatggcggacagggtggaggcggcgatgtacgtgtggcggcgcaag
gcgggcgccagccacgggaggtcgcggtggggcgccgtcaaggagctcgtcgccgacGAC
GAGGAGCAGGACAAGAACGTGATGCTGGCAGGCCGGGCGGAGAGCCTCCTCCTCTGCCTC
AAGCACAGGTTCCCCGGCTTGTCCCAGACCACCCTCGACACCAGCAAGATCCAGTTCAAC
AAGGATATTGGTCAGGCAATCCTGGAGAGCTACTCAAGGGTGCTGGAAAGCTTGGCTTTC
AACATCGTATCATGGATCGATGATGTCCTTTTTGCTGACAAGACGGTCAGGAAACAGTGA
GCGACAGCCAGAGCGTCTGGACTCTGGATTGAAGCTTCCCAACAAGAGCTTTAGATGTTT
CTGTTAGTGTAGCTGCCAAGAGAAAAAAAATTAAAGTAACAGTAGGTAGGGTGATTTTGC
TGACCTTAGTGAGGGAACTGTAAGCTTTAGCTTGCAACAATTATGTCTTGTATGACCAGC
AGTGGTTGTATGT

CDS

1440 bp

>Os10t0550300-00 Rop nucleotide exchanger, PRONE domain containing protein.
ATGGAGAGTAGCTCGTCGGTGTCGGTGTCCGACGAGAGCTCGGAGGCGAACGGCGGCGGG
TGCTGCTCGTCGTCGACGACGCCGAGCATGGACGCGGTGAACCTGAGCCGGACTTTCTCC
GACGTGTCGTCCTTCTCGGAGGAGCATGGCGGCAGCGGCAGCAGCGTCGACCACAGTGGC
CCGTTCGAGCCGCCGTCCGCCGCCGCCGTGTCGAGGCTGATCGGccgccgctcgccggct
gcggcggcctccgctctcagcctcagccgcctcagcatgaagccccgggccgacgtgctc
gaccggcgctccaccgacgacgagctggagctcgtcaaggagaggttctccaagctcctg
ctcggcgaggacatgtccggcggcggcaagggcgtctgcaccgccgtcgccatctccaac
gccatcaccaaCCTCTACGCCACGGTGTTCGGGAGTTGCCACAAGCTGGAGCCATTGCCG
GCGGGGAAGAAGACGATGTGGAGGAGGGAGATGGACTGCCTCCTCTCCGTATGCGACTAC
ATCGTCGAGTTCTACCCCTCCTCACAGACTCTCCCCGATGGCACCAAAGTCGAGGTCATG
GCCACCAGGCCAAGATCCGACATCTACATCAACCTCCCTGCTCTGGAGAAGCTCGATGCC
ATGCTCATTGAGATACTGGAGAGTTTTCAGAAGGCGGAGTTCTGGTACGCGGACGCCGGG
ACGAGGTCGTTCGGGTCGGCGACGTCGTCGTCGACGATGTCGTCGTCGTCGTTCCGGCGG
TCGACGCACCGGAACGAGGACAGGTGGTGGCTGCCGGTGCCGTGCGTCCCCGACGGCGGC
ATCTCCGGCAAGGCCCGCAAGGAGCTCCAGCAGAAGCGCGACTGCGCCACCCAGATCCAC
AAGGCCGCCGTCGCCATCAACACCGGCGTCCTCGGCGACATGGAGGTCCCCGACTCCTTC
ATGGCCATCCTCCCCAAGAGTGGGAaggcgagcgtgggggacggggtgtacagggcgatg
ctgggggcggagaagttctcgccggagtacctgctggactgcctggacatgtcgtcggag
cacgaggcgctggcgatggcggacagggtggaggcggcgatgtacgtgtggcggcgcaag
gcgggcgccagccacgggaggtcgcggtggggcgccgtcaaggagctcgtcgccgacGAC
GAGGAGCAGGACAAGAACGTGATGCTGGCAGGCCGGGCGGAGAGCCTCCTCCTCTGCCTC
AAGCACAGGTTCCCCGGCTTGTCCCAGACCACCCTCGACACCAGCAAGATCCAGTTCAAC
AAGGATATTGGTCAGGCAATCCTGGAGAGCTACTCAAGGGTGCTGGAAAGCTTGGCTTTC
AACATCGTATCATGGATCGATGATGTCCTTTTTGCTGACAAGACGGTCAGGAAACAGTGA

Protein

479 aa

>Os10t0550300-00 Rop nucleotide exchanger, PRONE domain containing protein.
MESSSSVSVSDESSEANGGGCCSSSTTPSMDAVNLSRTFSDVSSFSEEHGGSGSSVDHSG
PFEPPSAAAVSRLIGRRSPAAAASALSLSRLSMKPRADVLDRRSTDDELELVKERFSKLL
LGEDMSGGGKGVCTAVAISNAITNLYATVFGSCHKLEPLPAGKKTMWRREMDCLLSVCDY
IVEFYPSSQTLPDGTKVEVMATRPRSDIYINLPALEKLDAMLIEILESFQKAEFWYADAG
TRSFGSATSSSTMSSSSFRRSTHRNEDRWWLPVPCVPDGGISGKARKELQQKRDCATQIH
KAAVAINTGVLGDMEVPDSFMAILPKSGKASVGDGVYRAMLGAEKFSPEYLLDCLDMSSE
HEALAMADRVEAAMYVWRRKAGASHGRSRWGAVKELVADDEEQDKNVMLAGRAESLLLCL
KHRFPGLSQTTLDTSKIQFNKDIGQAILESYSRVLESLAFNIVSWIDDVLFADKTVRKQ*

CDS

chr10:21587170..21587608 (- strand) : 439 bp

chr10:21586930..21587084 (- strand) : 155 bp

chr10:21586750..21586824 (- strand) : 75 bp

chr10:21586357..21586665 (- strand) : 309 bp

chr10:21585537..21585881 (- strand) : 345 bp

chr10:21585008..21585124 (- strand) : 117 bp

3'UTR

chr10:21584815..21585007 (- strand) : 193 bp

FASTA

>Os10t0550300-00 class=Sequence position=chr10:21584815..21587608 (- strand)
ATGGAGAGTA GCTCGTCGGT GTCGGTGTCC GACGAGAGCT CGGAGGCGAA CGGCGGCGGG TGCTGCTCGT CGTCGACGAC
GCCGAGCATG GACGCGGTGA ACCTGAGCCG GACTTTCTCC GACGTGTCGT CCTTCTCGGA GGAGCATGGC GGCAGCGGCA
GCAGCGTCGA CCACAGTGGC CCGTTCGAGC CGCCGTCCGC CGCCGCCGTG TCGAGGCTGA TCGGccgccg ctcgccggct
gcggcggcct ccgctctcag cctcagccgc ctcagcatga agccccgggc cgacgtgctc gaccggcgct ccaccgacga
cgagctggag ctcgtcaagg agaggttctc caagctcctg ctcggcgagg acatgtccgg cggcggcaag ggcgtctgca
ccgccgtcgc catctccaac gccatcacca aCCTCTACGG TACGCAGCGC GATCGACATG ATCGCCGGCG AACTTGTTCT
TGCTAATCCG TGACCACCAT GACTAATCCG ACGAGCTAAT GCAGCCACGG TGTTCGGGAG TTGCCACAAG CTGGAGCCAT
TGCCGGCGGG GAAGAAGACG ATGTGGAGGA GGGAGATGGA CTGCCTCCTC TCCGTATGCG ACTACATCGT CGAGTTCTAC
CCCTCCTCAC AGACTCTCCC CGATGGCACC AAAGTCGAGG TATCCATCCA TGATCCATCC ATGGACGATT CAATGGATTT
CTACTTACCA AACGCCATGG CTGATTGATT GCTTGCTCCA TCTCCATTGC TGTTCATCCT GCAGGTCATG GCCACCAGGC
CAAGATCCGA CATCTACATC AACCTCCCTG CTCTGGAGAA GCTCGATGCC ATGCTCATTG TAAGATCCCA ACAAATTTGT
CGCAAATTAA AAACATGCTG AATTTGACGA ATTTTGGATG AGCTGAATTT CGAATTTGTG CAGGAGATAC TGGAGAGTTT
TCAGAAGGCG GAGTTCTGGT ACGCGGACGC CGGGACGAGG TCGTTCGGGT CGGCGACGTC GTCGTCGACG ATGTCGTCGT
CGTCGTTCCG GCGGTCGACG CACCGGAACG AGGACAGGTG GTGGCTGCCG GTGCCGTGCG TCCCCGACGG CGGCATCTCC
GGCAAGGCCC GCAAGGAGCT CCAGCAGAAG CGCGACTGCG CCACCCAGAT CCACAAGGCC GCCGTCGCCA TCAACACCGG
CGTCCTCGGC GACATGGAGG TCCCCGACTC CTTCATGGCC ATCCTCCCCA AGGTAATTAA ACAACATCAC CAACTCCAAT
GCAACAGTAA CATCACCATT TTTTTCCGAT AATAGAAGCT TTATATGAta cttcctctgt ttcacaatgt aagtcattct
aacatttctt acatttatat tgatgttgat gaatctagac atatatattt atataaattc attaatatca atatgaatgt
ggaaaatgct agaatgactt gtattgtgaa atggaggaag taCATTCTAA CGGAGcttac tcccggcctc cgtatgaaat
gcacacggcc acaaaacagg atctaactag accctcaaca caaaacaaaa aaattagtga ctatcaagcc gtagactaga
tcgccaccca tattccagag taaaaaaact cctatgccac ctgatccaaa caacgcgata ccaccaacaA TAGTATTTGT
CGTCATCATC TTCTTCTTCG TCTTGTTCAT CATCGTGTTC TTGGCAGAGT GGGAaggcga gcgtggggga cggggtgtac
agggcgatgc tgggggcgga gaagttctcg ccggagtacc tgctggactg cctggacatg tcgtcggagc acgaggcgct
ggcgatggcg gacagggtgg aggcggcgat gtacgtgtgg cggcgcaagg cgggcgccag ccacgggagg tcgcggtggg
gcgccgtcaa ggagctcgtc gccgacGACG AGGAGCAGGA CAAGAACGTG ATGCTGGCAG GCCGGGCGGA GAGCCTCCTC
CTCTGCCTCA AGCACAGGTT CCCCGGCTTG TCCCAGACCA CCCTCGACAC CAGCAAGATC CAGTTCAACA AGGTAATCAA
ACTAACTAAT CTACAATTCA TACAAATGCA ACAGCATTAG CATCCAACAT TAGCATTCAA CTAATCAAAG TACGCGAATG
CAAGAACAGC ATTGGCTTTC AACTAGTAAG AGCATGCAAA TGTAAGAACA AAATTGGTAC TCTTGATTCA GCTGATCAAA
GCATATAAAT GGCAAGAACA GCATTGGTAT TCAAGTAGTA ATTCAGAGCA TGAAAACTCA AGGATACCAT TGGTATTCAT
GATCCAGCTG ATCAAAGCAT ATAAAATGCA AGAACAGCAT TGGCATTCAA CTAATTCAGA GCATGCAGAT GCCAGCATTG
GCATTCTGTG ATCTATATCT TCTTTTCAAA TTCAAAATTT GATACGTTCC TGACCAAATG AGATTGGCAA AATTTTTCAT
GTAGGATATT GGTCAGGCAA TCCTGGAGAG CTACTCAAGG GTGCTGGAAA GCTTGGCTTT CAACATCGTA TCATGGATCG
ATGATGTCCT TTTTGCTGAC AAGACGGTCA GGAAACAGTG AGCGACAGCC AGAGCGTCTG GACTCTGGAT TGAAGCTTCC
CAACAAGAGC TTTAGATGTT TCTGTTAGTG TAGCTGCCAA GAGAAAAAAA ATTAAAGTAA CAGTAGGTAG GGTGATTTTG
CTGACCTTAG TGAGGGAACT GTAAGCTTTA GCTTGCAACA ATTATGTCTT GTATGACCAG CAGTGGTTGT ATGT

Locus: Os10g0550300

Loading...

Locus: Os10g0550300

Loading...