Os10t0563700-01

Locus

Os10g0563700

Description

Nucleoside diphosphate kinase, Root development, Defense response, Energy homeostasis

RAP-DB Gene Symbol Synonym(s)

OsNDPK4

RAP-DB Gene Name Synonym(s)

nucleoside diphosphate kinase 4

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Awd protein

Transcript Evidence

AK072751

Protein Evidence

Q7XC37

Literature

PMID: 32152790

Note

Manual Curation

March 12, 2020

Gene Ontology (GO)

Biological Process: nucleoside diphosphate phosphorylation (GO:0006165)

Biological Process: GTP biosynthetic process (GO:0006183)

Biological Process: UTP biosynthetic process (GO:0006228)

Biological Process: CTP biosynthetic process (GO:0006241)

Molecular Function: nucleoside diphosphate kinase activity (GO:0004550)

Functional domain (InterPro)

Nucleoside diphosphate kinase-like domain superfamily (IPR036850)

Nucleoside diphosphate kinase (IPR001564)

Nucleoside diphosphate kinase-like domain (IPR034907)

Nucleoside diphosphate kinase, active site (IPR023005)

Experimentally confirmed subcellular location

cytosol (GO:0005829)

Full-length cDNA

J023136C24 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0563700-01)

RiceXPro (AK072751)

Others

Oryzabase (16690)

KEGG (Os10t0563700-01 (EC:2.7.4.6))

Transcript

733 bp

>Os10t0563700-01 Nucleoside diphosphate kinase, Root development, Defense response, Energy homeostasis
CTTCTCCCTCAACCTACGGCGCCGACCACCTCCAAAACCAGACCCCGAAATCTCGAGGAG
CTTGTCTTTTTTCGGTAGCAATGGCGTTGGAGCAGACCTTCATCATGATCAAGCCCGACG
GCGTCCAGAGGGGCCTCATTGGCGAGGTCATCGGCCGCTTCGAGAAGAAGGGATTCTACC
TCAAAGCCATGAAGCTCATCAACGTGGAGAAGTCGTTCGCCGAGAAGCACTACGCCGATC
TGTCCTCCAAGCCCTTCTTCGGAGGGCTCGTGGAGTACATCGTCTCCGGCCCCGTCGTCG
CCATGGTCTGGGAGGGCAAGCAGGTCGTCTCCACCGGCCGCAAGCTCGTCGGGGCCACCA
ACCCCCTGGCCGCTGAGCCGGGCACCATCCGTGGCGACTTCGCTGTCGACATTGGCAGGA
ATGTCATCCACGGAAGCGACTCGGTCGAGAACGCCAGGAAGGAGATTGCTCTGTGGTTCC
CTGAGGGCATCGCCGAGTGGAGGAGCAACCAGCACCCATGGATCTATGAGGTCTAAAATG
CCTTGTCACTATGAACCTGGAGAGTTGGCATCTGAAGATCTACCGTGCTATTTAGCTGCT
ATTTTATAGTTGAGAATTGAGATCAGCATCTCAAGAACCTTTGTCTGTGCGAACTGAAGT
TTTTCTTCATTATGTTGCATGTTATGCATGCATTTACCAGTTGCTCTTGATATATGGTAT
TGCTTTAATCCTT

CDS

456 bp

>Os10t0563700-01 Nucleoside diphosphate kinase, Root development, Defense response, Energy homeostasis
ATGGCGTTGGAGCAGACCTTCATCATGATCAAGCCCGACGGCGTCCAGAGGGGCCTCATT
GGCGAGGTCATCGGCCGCTTCGAGAAGAAGGGATTCTACCTCAAAGCCATGAAGCTCATC
AACGTGGAGAAGTCGTTCGCCGAGAAGCACTACGCCGATCTGTCCTCCAAGCCCTTCTTC
GGAGGGCTCGTGGAGTACATCGTCTCCGGCCCCGTCGTCGCCATGGTCTGGGAGGGCAAG
CAGGTCGTCTCCACCGGCCGCAAGCTCGTCGGGGCCACCAACCCCCTGGCCGCTGAGCCG
GGCACCATCCGTGGCGACTTCGCTGTCGACATTGGCAGGAATGTCATCCACGGAAGCGAC
TCGGTCGAGAACGCCAGGAAGGAGATTGCTCTGTGGTTCCCTGAGGGCATCGCCGAGTGG
AGGAGCAACCAGCACCCATGGATCTATGAGGTCTAA

Protein

151 aa

>Os10t0563700-01 Nucleoside diphosphate kinase, Root development, Defense response, Energy homeostasis
MALEQTFIMIKPDGVQRGLIGEVIGRFEKKGFYLKAMKLINVEKSFAEKHYADLSSKPFF
GGLVEYIVSGPVVAMVWEGKQVVSTGRKLVGATNPLAAEPGTIRGDFAVDIGRNVIHGSD
SVENARKEIALWFPEGIAEWRSNQHPWIYEV*

5'UTR

chr10:22260356..22260435 (- strand) : 80 bp

CDS

chr10:22260299..22260355 (- strand) : 57 bp

chr10:22260161..22260209 (- strand) : 49 bp

chr10:22259635..22259866 (- strand) : 232 bp

chr10:22258222..22258339 (- strand) : 118 bp

3'UTR

chr10:22258025..22258221 (- strand) : 197 bp

FASTA

>Os10t0563700-01 class=Sequence position=chr10:22258025..22260435 (- strand)
CTTCTCCCTC AACCTACGGC GCCGACCACC TCCAAAACCA GACCCCGAAA TCTCGAGGAG CTTGTCTTTT TTCGGTAGCA
ATGGCGTTGG AGCAGACCTT CATCATGATC AAGCCCGACG GCGTCCAGAG GGGCCTCGTA AGCTTACCTT TCACTTCCCC
TCGCATCGAT TTGGTGTTGG CTAGTGCTTA GCTTCAATGT GTTTGTCTTT TGCTTGTTTT GCTCAGATTG GCGAGGTCAT
CGGCCGCTTC GAGAAGAAGG GATTCTACCT CAAAGGTAAC CATGCCCACC TTGCCAATGA TCCTGATTTG TGCTTGCGCT
GCACCGTGAG AAGATTAGAT TGAATCTTTG TGCTACACAA CACGATGTGC CATGCTATTT ATGTGTTAAA AGGATTTCTC
TCTCTCCCTC TGAAACTAAG CATGTTTTGT TGTTGAGTAG CTTAATTTCT TCGATCTTTC CTCACTCCGT GGGTCTAATT
AGTGGCTTGT TTGATGATTT ATGCATCGAT TGCTCTGTGG GGAGCGATGA TTTTTTTTCT TTTTGCTGAT ATGCTATCTG
AACATGCAGC CATGAAGCTC ATCAACGTGG AGAAGTCGTT CGCCGAGAAG CACTACGCCG ATCTGTCCTC CAAGCCCTTC
TTCGGAGGGC TCGTGGAGTA CATCGTCTCC GGCCCCGTCG TCGCCATGGT CTGGGAGGGC AAGCAGGTCG TCTCCACCGG
CCGCAAGCTC GTCGGGGCCA CCAACCCCCT GGCCGCTGAG CCGGGCACCA TCCGTGGCGA CTTCGCTGTC GACATTGGCA
GGTCAGGTTT CGTTCATTCA CTCTGTGGTT TACATTCATC AGTGGGTGAT AAATTTTAAT TCAGTTGCAT CCTCCACTGC
TTGCTCACTC TTAATTTTGA TTTGCTCATA TGTTGCTGTG CGCCAGATTC AAATGCAAAT TCCACTGGAG TATAATTAGA
GATGCCCATC ACAGTTATTC TAAGATGCTT TATTTTCAGA AACAGATGCT AAAATGATTT TTTTCCTCCC AAGAGGCATG
GTATTAAATG CTTTTGGAGA AACACCTAAA CTTATGTAGC ACATGAAGGC TTGTGTAGTT CAAAATTACT TATGTTTCTA
AAGTACATTT TGGTGTGTTG TTTATTTTAT TGTGCAATAT ATAGCATTGG TCTGTCCTGG GAGCTTAGTT GACTGACTCC
CTGTTGAATA GTTCTGTCTA GCTTAAGCAT GGTGAGAGCA TCTGACAGGG CCATATGCAA TGTTTTATGC ACTTTGAAGT
ACCAAGTGAT ACACTGTCCA ATCATACCAA ATAATTGCAA CCGTGCTGAT TCATTCTACT ACTAGTATCT TATTGATTGA
ATTTTGGTTT ATATATCACT TTATGGGTCC ACTGTGGGAC AGCACCATGT GCTACATGGT TTACCATGAT TAACCTTGCA
TCCAAATTTT CCAAGTCTAA TTCGTGGTCC ACAGAAAAAA TATATACTTT CTTAATGAAT AAGAGTGCAT TTTACCATGT
GAATGTTTCA ATGGCCCAAT AACACTTCAT CATTTCGACC AGCAAAAACA AAAAACAATC ATTAGGACTG GCATCTTACT
ATCACAATGA TTGCCTTGta ctccctctat tccacattga tctacatatt tcataggtac accaagacca agaaaaacta
ataactctct catactatat ttactctagc aacaaactcg atgtatgcac catccccaat atttcctagt caatagcaaa
ttaagatatt gcatgtgggt tataaatact tgtgtgcatg gatacatgca tcaatgttca tttactccaa tgcacaaata
acgaatagac ttaataagtg aacacaaata tgtagatcat ttaggaataa cctcagaaaa actatacgta gatcaatttg
gaatggaggg agtaTGTAAG GACAAGTATG GTCGACAGAA CACCAAATGG TGCTCTAGAG TCCTTCAAAT TTACCTTTCT
ACTAGTACTC ATGTTATCCC TTTGAGTTCT CATCTGTTCA TAGACCTAAA TATGTATCCA GAATCCAAGT TCTAAAGATG
ACCTCATACC TTGCAGGAAT GTCATCCACG GAAGCGACTC GGTCGAGAAC GCCAGGAAGG AGATTGCTCT GTGGTTCCCT
GAGGGCATCG CCGAGTGGAG GAGCAACCAG CACCCATGGA TCTATGAGGT CTAAAATGCC TTGTCACTAT GAACCTGGAG
AGTTGGCATC TGAAGATCTA CCGTGCTATT TAGCTGCTAT TTTATAGTTG AGAATTGAGA TCAGCATCTC AAGAACCTTT
GTCTGTGCGA ACTGAAGTTT TTCTTCATTA TGTTGCATGT TATGCATGCA TTTACCAGTT GCTCTTGATA TATGGTATTG
CTTTAATCCT T

Locus: Os10g0563700

Loading...

Locus: Os10g0563700

Loading...