Os10t0569400-01

Locus

Os10g0569400

Description

RIR1a protein precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RIR1B

CGSNL Gene Name

RICE PATHOGEN-RELATED PROTEIN

Oryzabase Gene Symbol Synonym(s)

Rir1b, Rir1a, OsRALF-28, OsRALF28, RALF-28, RALF28

Oryzabase Gene Name Synonym(s)

Rice pathogen-related protein, Rapid alkalization factor 28

Transcript Evidence

AK062449 (DDBJ, Best hit)

Protein Evidence

O24233 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-103-C01 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0569400-01)

RiceXPro (AK062449)

Others

Oryzabase (6406)

KEGG (Os10t0569400-01)

Transcript

631 bp

>Os10t0569400-01 RIR1a protein precursor.
ACACAACAAACAAACCAAGAGCTAAAATTTCAGTCAGTGATGATGAGGAAGCAAAGCCGC
TCTCCTTGTTCATCTTCTTCTTCTGCTGCTGTTGTGTCCCTCTGCAAGGTGCTCCTGTTG
GTCCTGGCTCTCATCTGCACCCTGGAAACTGTCTCAGTAGAAGGAGGGAGAGTGGCAGCA
GCAGCATTAGTTGGTGGGGGCGTACCACTGAATCCACGGTACCCGGCGATTCCTGAAGAA
CCTTACATAGGCCGGAGAGGCGATCCGTACACAGGTCGGGGAGGCGAACCTTACACACGC
CCGGGACGGGGATGCACCGTTGCATACGGATGCTATGGAGGTCCTCCAGCTGCCAAACCA
TGACGATCGACATACTACTCTGCTACTGCTACTGCATGCTCGCTTGTTATTTCGATCGAT
CAATCTCATGGCCTGCGTAGCTCACCACATAAACAAATAAAAACTATGCATCTAATAATT
AACCCCTGATCTATCGATCGATCAGTAGACGGGTATGCATCAATCGGCATCAGCAGCATA
TGCGATGTGAATTGTGATGTATGCATGGTGTATTTTTGTGGTAAATAAAGTGAAGCAGAT
ATCTATCTAGTATATACACATCGTTCCTGCT

CDS

324 bp

>Os10t0569400-01 RIR1a protein precursor.
ATGATGAGGAAGCAAAGCCGCTCTCCTTGTTCATCTTCTTCTTCTGCTGCTGTTGTGTCC
CTCTGCAAGGTGCTCCTGTTGGTCCTGGCTCTCATCTGCACCCTGGAAACTGTCTCAGTA
GAAGGAGGGAGAGTGGCAGCAGCAGCATTAGTTGGTGGGGGCGTACCACTGAATCCACGG
TACCCGGCGATTCCTGAAGAACCTTACATAGGCCGGAGAGGCGATCCGTACACAGGTCGG
GGAGGCGAACCTTACACACGCCCGGGACGGGGATGCACCGTTGCATACGGATGCTATGGA
GGTCCTCCAGCTGCCAAACCATGA

Protein

108 aa

>Os10t0569400-01 RIR1a protein precursor.
MMRKQSRSPCSSSSSAAVVSLCKVLLLVLALICTLETVSVEGGRVAAAALVGGGVPLNPR
YPAIPEEPYIGRRGDPYTGRGGEPYTRPGRGCTVAYGCYGGPPAAKP*

5'UTR

chr10:22575212..22575250 (+ strand) : 39 bp

CDS

chr10:22575251..22575377 (+ strand) : 127 bp

chr10:22576067..22576263 (+ strand) : 197 bp

3'UTR

chr10:22576264..22576531 (+ strand) : 268 bp

FASTA

>Os10t0569400-01 class=Sequence position=chr10:22575212..22576531 (+ strand)
ACACAACAAA CAAACCAAGA GCTAAAATTT CAGTCAGTGA TGATGAGGAA GCAAAGCCGC TCTCCTTGTT CATCTTCTTC
TTCTGCTGCT GTTGTGTCCC TCTGCAAGGT GCTCCTGTTG GTCCTGGCTC TCATCTGCAC CCTGGAAACT GTCTCAGTAG
AAGGAGGTAA ATACTTCCTC TGTCTCACAA AAAATAACTA CAATACACGA ATCTGAACAA ACATTCATCC AATCCAAGTT
TACCCTCAGA AATTGGCTTT TATGGGACAG AAGATGCACA TATTTAAACT CATAATCATT GAGAGTTAAT CAATTACTCT
CTCTGGTTat gttttggata agattgtagt caaactttta taactttaat tatcaaaatt ttaaaagtat ttagtttaaa
agaactagac caacatatat gtatttgtcg ttcaaagttc tataataaaa ataaacatgt atttatttat tctatatatt
ataatagaaa aacaagatca aagatatatt ttgaagactg tgttattgtc taaaacgtca agaattataa aaccgaagga
agTACTAAgg ctgtgttgga ggaggagata gagaagattg agaagatacg taaaacgagg tgagccattt agcacatgat
taattaaata ttagctattt taaactttaa aaatggatta atatgatttt ctaaagcaac ttttctgtaa aaactttttg
caaaaaatac accgtttagt agtttgggaa gcgtgcgtac ggaaaacgaa acaaacaatc tccctatcac cccagaacga
acgcagccTA AGTTACTTGG TTGGTTAACT AAATTTGGTA TCTGGATGGA TGCAGGGAGA GTGGCAGCAG CAGCATTAGT
TGGTGGGGGC GTACCACTGA ATCCACGGTA CCCGGCGATT CCTGAAGAAC CTTACATAGG CCGGAGAGGC GATCCGTACA
CAGGTCGGGG AGGCGAACCT TACACACGCC CGGGACGGGG ATGCACCGTT GCATACGGAT GCTATGGAGG TCCTCCAGCT
GCCAAACCAT GACGATCGAC ATACTACTCT GCTACTGCTA CTGCATGCTC GCTTGTTATT TCGATCGATC AATCTCATGG
CCTGCGTAGC TCACCACATA AACAAATAAA AACTATGCAT CTAATAATTA ACCCCTGATC TATCGATCGA TCAGTAGACG
GGTATGCATC AATCGGCATC AGCAGCATAT GCGATGTGAA TTGTGATGTA TGCATGGTGT ATTTTTGTGG TAAATAAAGT
GAAGCAGATA TCTATCTAGT ATATACACAT CGTTCCTGCT