Os10t0572300-01

Locus

Os10g0572300

Description

Leucine-rich repeat, typical subtype containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL5

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 5

Transcript Evidence

AK102709 (DDBJ, Best hit)

Protein Evidence

B6SVK6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

J033104H23 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0572300-01)

RiceXPro (AK102709)

Others

Oryzabase (14435)

KEGG (Os10t0572300-01)

Transcript

2098 bp

>Os10t0572300-01 Leucine-rich repeat, typical subtype containing protein.
TCTCTCATCTCTCGTCGTTTTCTCTCTCCTCGATCGAGGGCACGCGACGCGCCATGGCGT
CGGCGGCGGAGGCGGTGGAGGAGCTCACGAGGCTGTACCGGGAGCTCCCGCCGCGCCCCG
CCGTCGAGGAGGTGGAGGCGGCGGAGGCCGTGCTGGCCTCGGCCGACGCGGAGGAGGCGG
CGCGCCTCGATGAGGTGGCGCGGGAGGAGGCCTCGGCCTCAGCGTCCTCGTCGGCGGCGG
CGCCGGGGCGGGCCGACGGGGAGCTCCTCGCCGTGCTGCGGGAGGCCAGGCGCAACGCCG
TGCGGCTCCGCGCGCTGCAGCAGCGGAAGGAGGCCGCGTACGTCGTCGAGCTCGAGAGGC
GCTTCAAGGTGTTCGACGATTTGATCCAGAGGGCGTCGCGGGTGGTCTCCTCCTCCTCCG
ACGCCGCCGAAGCGGGAGGGGGAACCACCGGCGATGGATACGTTGGTGTTGGTGCGGACA
GCGTGGACCTGGAGATGGAGCTGAGGAAGAAGGAGGCGGCGGTTGCGGCCGCGGCCGCCG
TCGCGGAGATGGAGCGCGGAAGCAAGGGTCTCGCTGCCCTGGGCTTGGAGTCCAAGCCCA
TCTCCTCGCTACGCCGTGATGTCTCTGCAGGTACTGACATGGAAAAATTGAGCCTTATCC
AAGTGGCAAGCCTGATAGAGTCATCAGCAAAGAAAGGGATCACAGAACTCAGCCTCCGGG
GGAAACTGGTCGACCAGATCGAGTGGCTCCCTGTTTCACTCGGCAAATTGCAAGATGTTA
CCGAGCTTGATCTTTCCGAGAATAGGATCATGGCACTCCCATCAACAATTGGCAGCCTTA
GATATTTGACAAAGCTTGACCTACACTCAAATCAGCTGATCAATCTGCCCGACGCGTTTG
GGGAACTCTCCAACCTAATTGATCTTGACCTGCATGCCAACCAGCTTAAGTCTCTTCCTT
CATCATTTGGAAATCTCACGAGCCTAGCAAACCTTGACCTGAGCTCAAATATGTTGAAGG
CTCTTCCAGATTGTTTAGGAAAATTGGCAAACTTGAGAAGATTAATTGTTGAGACAAATG
AGCTTGAGGAGCTACCCTATACTATTGGATCTTGCACATCTCTTGTGGAGCTTAGGTTGG
ATTTCAATCAGTTAAAAGCCCTTCCAGAGGCCATTGGGAAGTTGGAGAAGCTGGAAATAC
TGACATTGCACTATAACAGAATCAAAGGATTGCCTACAACAGTGGGTTCACTTTCCAGAT
TGAGAGAGCTGGATGTCAGTTTTAATGAGGTTGAAGTAATCCCTGAGAACATTTGCTTTG
CGACAAGTCTTGTGAAGTTGAATCTCAGCAGGAATTTTGCAGACTTAAGAGCACTGCCGA
AATCAATAGGAAATCTTGAGATGCTAGAGGAGCTGGACATAAGCAGTAACCAGATACGGG
TACTGCCAGATTCGTTCAGGTGTCTTTCGAGGCTACGTGTATTTCATGCTGATGAGACTC
CACTTGAATTTCCACCAAGAGAAGTTGTAAAGTTAGGGGCTCAGGCTGTGGTCAAGTATA
TGAATGATTTGAATGCTGCAAGAGGAACAAACCAGAAGAAAACAGATCGGGGAAGCTTCT
GGACCTGGCTCTTCTCGCTGTTTGGTTGTTGCAAAAAGAACCAAGAAGTGGGATTGCCAG
TATAACTGAAGCATTTCATCATCTGTATGTATGTTGTGAATTACTCAGGAAGAGTCAAGA
GATACAAGGAAGGTGAAACTATTCAGAAAGCAAAAAAACCAGCTGCGCAGATTAGTCCCT
GAAGCTCCATAAGgtacaccgcaatatatttttcaaggccgctacaccatcctgaaaata
ttgataatgtttcaaaataaacttcatcatattgctatgctccaagacacttgtagaaat
acaaacatggttctctacagacattttatttacttatgcaaacaacaaatcttagttctg
ttcagcaagtctattgcatcagaatttgacctattgggtctaatggttttgttgtaaaac
tatattaatttgttactgcatcaaacatgtactcaaaggtgaaggttgagtttcgttt

CDS

1632 bp

>Os10t0572300-01 Leucine-rich repeat, typical subtype containing protein.
ATGGCGTCGGCGGCGGAGGCGGTGGAGGAGCTCACGAGGCTGTACCGGGAGCTCCCGCCG
CGCCCCGCCGTCGAGGAGGTGGAGGCGGCGGAGGCCGTGCTGGCCTCGGCCGACGCGGAG
GAGGCGGCGCGCCTCGATGAGGTGGCGCGGGAGGAGGCCTCGGCCTCAGCGTCCTCGTCG
GCGGCGGCGCCGGGGCGGGCCGACGGGGAGCTCCTCGCCGTGCTGCGGGAGGCCAGGCGC
AACGCCGTGCGGCTCCGCGCGCTGCAGCAGCGGAAGGAGGCCGCGTACGTCGTCGAGCTC
GAGAGGCGCTTCAAGGTGTTCGACGATTTGATCCAGAGGGCGTCGCGGGTGGTCTCCTCC
TCCTCCGACGCCGCCGAAGCGGGAGGGGGAACCACCGGCGATGGATACGTTGGTGTTGGT
GCGGACAGCGTGGACCTGGAGATGGAGCTGAGGAAGAAGGAGGCGGCGGTTGCGGCCGCG
GCCGCCGTCGCGGAGATGGAGCGCGGAAGCAAGGGTCTCGCTGCCCTGGGCTTGGAGTCC
AAGCCCATCTCCTCGCTACGCCGTGATGTCTCTGCAGGTACTGACATGGAAAAATTGAGC
CTTATCCAAGTGGCAAGCCTGATAGAGTCATCAGCAAAGAAAGGGATCACAGAACTCAGC
CTCCGGGGGAAACTGGTCGACCAGATCGAGTGGCTCCCTGTTTCACTCGGCAAATTGCAA
GATGTTACCGAGCTTGATCTTTCCGAGAATAGGATCATGGCACTCCCATCAACAATTGGC
AGCCTTAGATATTTGACAAAGCTTGACCTACACTCAAATCAGCTGATCAATCTGCCCGAC
GCGTTTGGGGAACTCTCCAACCTAATTGATCTTGACCTGCATGCCAACCAGCTTAAGTCT
CTTCCTTCATCATTTGGAAATCTCACGAGCCTAGCAAACCTTGACCTGAGCTCAAATATG
TTGAAGGCTCTTCCAGATTGTTTAGGAAAATTGGCAAACTTGAGAAGATTAATTGTTGAG
ACAAATGAGCTTGAGGAGCTACCCTATACTATTGGATCTTGCACATCTCTTGTGGAGCTT
AGGTTGGATTTCAATCAGTTAAAAGCCCTTCCAGAGGCCATTGGGAAGTTGGAGAAGCTG
GAAATACTGACATTGCACTATAACAGAATCAAAGGATTGCCTACAACAGTGGGTTCACTT
TCCAGATTGAGAGAGCTGGATGTCAGTTTTAATGAGGTTGAAGTAATCCCTGAGAACATT
TGCTTTGCGACAAGTCTTGTGAAGTTGAATCTCAGCAGGAATTTTGCAGACTTAAGAGCA
CTGCCGAAATCAATAGGAAATCTTGAGATGCTAGAGGAGCTGGACATAAGCAGTAACCAG
ATACGGGTACTGCCAGATTCGTTCAGGTGTCTTTCGAGGCTACGTGTATTTCATGCTGAT
GAGACTCCACTTGAATTTCCACCAAGAGAAGTTGTAAAGTTAGGGGCTCAGGCTGTGGTC
AAGTATATGAATGATTTGAATGCTGCAAGAGGAACAAACCAGAAGAAAACAGATCGGGGA
AGCTTCTGGACCTGGCTCTTCTCGCTGTTTGGTTGTTGCAAAAAGAACCAAGAAGTGGGA
TTGCCAGTATAA

Protein

544 aa

>Os10t0572300-01 Leucine-rich repeat, typical subtype containing protein.
MASAAEAVEELTRLYRELPPRPAVEEVEAAEAVLASADAEEAARLDEVAREEASASASSS
AAAPGRADGELLAVLREARRNAVRLRALQQRKEAAYVVELERRFKVFDDLIQRASRVVSS
SSDAAEAGGGTTGDGYVGVGADSVDLEMELRKKEAAVAAAAAVAEMERGSKGLAALGLES
KPISSLRRDVSAGTDMEKLSLIQVASLIESSAKKGITELSLRGKLVDQIEWLPVSLGKLQ
DVTELDLSENRIMALPSTIGSLRYLTKLDLHSNQLINLPDAFGELSNLIDLDLHANQLKS
LPSSFGNLTSLANLDLSSNMLKALPDCLGKLANLRRLIVETNELEELPYTIGSCTSLVEL
RLDFNQLKALPEAIGKLEKLEILTLHYNRIKGLPTTVGSLSRLRELDVSFNEVEVIPENI
CFATSLVKLNLSRNFADLRALPKSIGNLEMLEELDISSNQIRVLPDSFRCLSRLRVFHAD
ETPLEFPPREVVKLGAQAVVKYMNDLNAARGTNQKKTDRGSFWTWLFSLFGCCKKNQEVG
LPV*

5'UTR

chr10:22690792..22690844 (+ strand) : 53 bp

CDS

chr10:22690845..22691421 (+ strand) : 577 bp

chr10:22692403..22693316 (+ strand) : 914 bp

chr10:22693405..22693545 (+ strand) : 141 bp

3'UTR

chr10:22693546..22693588 (+ strand) : 43 bp

chr10:22694040..22694124 (+ strand) : 85 bp

chr10:22694863..22695147 (+ strand) : 285 bp

FASTA

>Os10t0572300-01 class=Sequence position=chr10:22690792..22695147 (+ strand)
TCTCTCATCT CTCGTCGTTT TCTCTCTCCT CGATCGAGGG CACGCGACGC GCCATGGCGT CGGCGGCGGA GGCGGTGGAG
GAGCTCACGA GGCTGTACCG GGAGCTCCCG CCGCGCCCCG CCGTCGAGGA GGTGGAGGCG GCGGAGGCCG TGCTGGCCTC
GGCCGACGCG GAGGAGGCGG CGCGCCTCGA TGAGGTGGCG CGGGAGGAGG CCTCGGCCTC AGCGTCCTCG TCGGCGGCGG
CGCCGGGGCG GGCCGACGGG GAGCTCCTCG CCGTGCTGCG GGAGGCCAGG CGCAACGCCG TGCGGCTCCG CGCGCTGCAG
CAGCGGAAGG AGGCCGCGTA CGTCGTCGAG CTCGAGAGGC GCTTCAAGGT GTTCGACGAT TTGATCCAGA GGGCGTCGCG
GGTGGTCTCC TCCTCCTCCG ACGCCGCCGA AGCGGGAGGG GGAACCACCG GCGATGGATA CGTTGGTGTT GGTGCGGACA
GCGTGGACCT GGAGATGGAG CTGAGGAAGA AGGAGGCGGC GGTTGCGGCC GCGGCCGCCG TCGCGGAGAT GGAGCGCGGA
AGCAAGGGTC TCGCTGCCCT GGGCTTGGAG TCCAAGCCCA TCTCCTCGCT ACGCCGTGAT GTCTCTGCAG GTAATTTGCT
TTCAAGTACA GTATTATTTT GTCGGAATCA CGAAATCCTA AAAATCTTTG TACTACTATA TATCCATGTG TGATGGTTTC
GATGCTGCCG TGTTCTATGG ACCCGACATA ATTTTGCAGT ATCTGTTTTT TTTTCCGGTT AAATTTCACT ACCTTGCACG
AATTGGATGC TCATGTCATG CATATGGGCG TAATATTTCC ATTACGATGT GGTTGCTACC TTTTATATAG AAAGAATCAC
TAGAAATAAT TGTCAACTGA CGTAATGGCG TACTGATTTG TTAGTGTTGC TTTGATTTTC TTCAACTAGT TGCCATTTAA
TTGCACACTG TTTATAAATT GCCTATTCTT GTTTCACTAG TACTATAATT GGAAACATAG AGGAGCGGTC TCGTAGTTTG
TGATGATTCT GTATTTCTGC TTGTTGGTTT AGCAAATTAC ACGATTGATG TCTACAAGGT ACCAGTGTAC CGCAACTGAT
TTTTCACCTT TCGCTATGAG TTAGCGTTTG ATGTGAACAA CCACCTCTGC AGCCAATTGT CACATCACAT CCATTTCTTC
AAAGGAATTT CGTGCTATTT TGTGATTTCT TTTTTCTTGA CATAATGCAT TAGTCGTTTG TTGGTCCCAG CTTTAATTTT
TAATTTTCTT GCGGTAGTTG GAGGACCATT CCCTTGTTGG TCACTGCTGG ACCTGGTGTA TCATTTGTCT CTTGTGCCTG
GTGATCTGAT ATTGTTAATT CATTTGTTAC CAGTTAGGCA ATAGCATAAT TATTTGTCTG AATACGATAT GAATCATGAG
CAATTAGTCA TTTTGCTTTG TTGACTTTGG AGGTGCTATC TAATGTAGGC CTTAATCATG CTTAGGCAAG TAGTGATCAT
CAAATTTGTA ACGGTACCAT AAATGTGATC AGCATTTTTG AGATGTCAGT ACTTGTGTTA TCCTAAGTTC CACTTGTCAA
TATCCCTGCA GGTACTGACA TGGAAAAATT GAGCCTTATC CAAGTGGCAA GCCTGATAGA GTCATCAGCA AAGAAAGGGA
TCACAGAACT CAGCCTCCGG GGGAAACTGG TCGACCAGAT CGAGTGGCTC CCTGTTTCAC TCGGCAAATT GCAAGATGTT
ACCGAGCTTG ATCTTTCCGA GAATAGGATC ATGGCACTCC CATCAACAAT TGGCAGCCTT AGATATTTGA CAAAGCTTGA
CCTACACTCA AATCAGCTGA TCAATCTGCC CGACGCGTTT GGGGAACTCT CCAACCTAAT TGATCTTGAC CTGCATGCCA
ACCAGCTTAA GTCTCTTCCT TCATCATTTG GAAATCTCAC GAGCCTAGCA AACCTTGACC TGAGCTCAAA TATGTTGAAG
GCTCTTCCAG ATTGTTTAGG AAAATTGGCA AACTTGAGAA GATTAATTGT TGAGACAAAT GAGCTTGAGG AGCTACCCTA
TACTATTGGA TCTTGCACAT CTCTTGTGGA GCTTAGGTTG GATTTCAATC AGTTAAAAGC CCTTCCAGAG GCCATTGGGA
AGTTGGAGAA GCTGGAAATA CTGACATTGC ACTATAACAG AATCAAAGGA TTGCCTACAA CAGTGGGTTC ACTTTCCAGA
TTGAGAGAGC TGGATGTCAG TTTTAATGAG GTTGAAGTAA TCCCTGAGAA CATTTGCTTT GCGACAAGTC TTGTGAAGTT
GAATCTCAGC AGGAATTTTG CAGACTTAAG AGCACTGCCG AAATCAATAG GAAATCTTGA GATGCTAGAG GAGCTGGACA
TAAGCAGTAA CCAGATACGG GTACTGCCAG ATTCGTTCAG GTGTCTTTCG AGGCTACGTG TATTTCATGC TGATGAGACT
CCACTTGAAT TTCCACCAAG AGAAGTTGTA AAGTTAGGGG CTCAGGTACA CATTATACTG CCGTTCTGCC ATATTTGCTT
ACTTAGTCCT TCGCTTTCTT TAAATGATTA ACAATGTTTC TTCTGCATGC CAGGCTGTGG TCAAGTATAT GAATGATTTG
AATGCTGCAA GAGGAACAAA CCAGAAGAAA ACAGATCGGG GAAGCTTCTG GACCTGGCTC TTCTCGCTGT TTGGTTGTTG
CAAAAAGAAC CAAGAAGTGG GATTGCCAGT ATAACTGAAG CATTTCATCA TCTGTATGTA TGTTGTGAAT TACTCAGGTC
TGCAAAGAAA GGAAACGTGG ATAATTTGGT TCCTCTTGTT TTTTTTGTCC CTTTTTTTTG GTGTGTATAT ATGTAATTTT
GTCATGTAAG GTCCATTTCT AGTTATGCAA GACCTATTAA GATTCATTTC TGTGTGTAAC TTCATTTGTA TGATAGCATG
TTACTGCTTC CATATTAAAA ACTGTCTTAC AGCAAGTATT ATATGGTTAT ATTCTAGTTA CTGCTCTTTG CTCTTGTATT
AGAAGTGAGA AGTGGCGACA ATGTCAGTTT GTGCCTCATT CTGGTTACTG TGGGGGAAAA ACTGACCCTT GTTCTTGATC
ATATCCATCA TGCTAATGTG CCAAACCTGA ATATATTGCG TTCATGTATA TATAATCTGT AATGGATAAT ATATGTAACA
CATTTTTATT TACTGATATT ATTGTGGTAA TATTTTCTTG CTTAGCAGGA AGAGTCAAGA GATACAAGGA AGGTGAAACT
ATTCAGAAAG CAAAAAAACC AGCTGCGCAG ATTAGTCCCT GAAGCTCCAT AAGGTTTTTT GCTGTACTTG TTTTAGTAAT
TCAGTCACAT AACTTAATTT GTGCATTTTG TGCCTTTTTC TTCCCCTTAT GGCTTAATTT GACTTAGCGT GCCAATTGTC
AAGAGTTATA GTTTTTGCAT CTGCTCTATA TTTTAGAAAT TGAGAGGCCT GGTTTATCGG CCTTTGGCAA ATCTAGAATA
CAAGTAACAA CATGCTTCTT TCATTAAAAA GAGTTAACAA CGTGGCCACG ATGATGTATA CCCCTTGAGT CACGTCATGG
TTACTGGGAA GGATGCGAAT AGTTGGATTC CAAGGTCATT TAAGTTGACT AGGTGGCACT TGATATCAAA AAAGTTCAAG
ACTGATGACT CCTGCTGAGC TGTCTAGAGT AAACTGTATA GTGTAGAATA GCTTTCTGTT AAGAATTGAG ACGCACATGA
TATTGGAATG CATCAGCAGT GGAACAAGTA TTCAGTTTCA TCCTTGACCA GACCTTTACT TATGCTTCCA CCACTTAAAA
CTAGATGATA TCCTGCGCGG GTTGCTTCGG AATATTTATA TTGAAATGTA GTAGAATTTA AAGATTCATG TACACTTTGT
GAGATAAAAA AATACTAATA AAAAGAAGGG AAACCGAGGC AAAACAGATT AACCCAGTAA ATTGCTTGCA GCATTATGTT
ATTTGAAGGG AAAAAatgta accaatccat agtcttttct aatagtattg agtttggcat atttttttca ggtacaccgc
aatatatttt tcaaggccgc tacaccatcc tgaaaatatt gataatgttt caaaataaac ttcatcatat tgctatgctc
caagacactt gtagaaatac aaacatggtt ctctacagac attttattta cttatgcaaa caacaaatct tagttctgtt
cagcaagtct attgcatcag aatttgacct attgggtcta atggttttgt tgtaaaacta tattaatttg ttactgcatc
aaacatgtac tcaaaggtga aggttgagtt tcgttt

Locus: Os10g0572300

Loading...

Locus: Os10g0572300

Loading...