Os10t0572300-02

Locus

Os10g0572300

Description

Similar to Protein lap4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL5

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 5

Transcript Evidence

AK065479 (DDBJ, Best hit)

Protein Evidence

B6SVK6 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

J013025D12 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0572300-02)

Others

Oryzabase (14435)

Transcript

1470 bp

>Os10t0572300-02 Similar to Protein lap4.
TGGATACGTTGGTGTTGGTGCGGACAGCGTGGACCTGGAGATGGAGCTGAGGAAGAAGGA
GGCGGCGGTTGCGGCCGCGGCCGCCGTCGCGGAGATGGAGCGCGGAAGCAAGGGTCTCGC
TGCCCTGGGCTTGGAGTCCAAGCCCATCTCCTCGCTACGCCGTGATGTCTCTGCAGGTAC
TGACATGGAAAAATTGAGCCTTATCCAAGTGGCAAGCCTGATAGAGTCATCAGCAAAGAA
AGGGATCACAGAACTCAGCCTCCGGGGGAAACTGGTCGACCAGATCGAGTGGCTCCCTGT
TTCACTCGGCAAATTGCAAGATGTTACCGAGCTTGATCTTTCCGAGAATAGGATCATGGC
ACTCCCATCAACAATTGGCAGCCTTAGATATTTGACAAAGCTTGACCTACACTCAAATCA
GCTGATCAATCTGCCCGACGCGTTTGGGGAACTCTCCAACCTAATTGATCTTGACCTGCA
TGCCAACCAGCTTAAGTCTCTTCCTTCATCATTTGGAAATCTCACGAGCCTAGCAAACCT
TGACCTGAGCTCAAATATGTTGAAGGCTCTTCCAGATTGTTTAGGAAAATTGGCAAACTT
GAGAAGATTAATTGTTGAGACAAATGAGCTTGAGGAGCTACCCTATACTATTGGATCTTG
CACATCTCTTGTGGAGCTTAGGTTGGATTTCAATCAGTTAAAAGCCCTTCCAGAGGCCAT
TGGGAAGTTGGAGAAGCTGGAAATACTGACATTGCACTATAACAGAATCAAAGGATTGCC
TACAACAGTGGGTTCACTTTCCAGATTGAGAGAGCTGGATGTCAGTTTTAATGAGGTTGA
AGTAATCCCTGAGAACATTTGCTTTGCGACAAGTCTTGTGAAGTTGAATCTCAGCAGGAA
TTTTGCAGACTTAAGAGCACTGCCGAAATCAATAGGAAATCTTGAGATGCTAGAGGAGCT
GGACATAAGCAGTAACCAGATACGGGTACTGCCAGATTCGTTCAGGTGTCTTTCGAGGCT
ACGTGTATTTCATGCTGATGAGACTCCACTTGAATTTCCACCAAGAGAAGTTGTAAAGTT
AGGGGCTCAGGCTGTGGTCAAGTATATGAATGATTTGAATGCTGCAAGAGGAACAAACCA
GAAGAAAACAGATCGGGGAAGCTTCTGGACCTGGCTCTTCTCGCTGTTTGGTTGTTGCAA
AAAGAACCAAGAAGTGGGATTGCCAGTATAACTGAAGCATTTCATCATCTGTATGTATGT
TGTGAATTACTCAGGTCTGCAAAGAAAGGAAACGTGGATAATTTGGTTCCTCTTGTTTTT
TTTGTCCCTTTTTTTTGGTGTGTATATATGTAATTTTGTCATGTAAGGTCCATTTCTAGT
TATGCAAGACCTATTAAGATTCATTTCTGTGTGTAACTTCATTTGTATGATAGCATGTTA
CTGCTTCCATATTAAAAACTGTCTTACAGC

CDS

1230 bp

>Os10t0572300-02 Similar to Protein lap4.
GGATACGTTGGTGTTGGTGCGGACAGCGTGGACCTGGAGATGGAGCTGAGGAAGAAGGAG
GCGGCGGTTGCGGCCGCGGCCGCCGTCGCGGAGATGGAGCGCGGAAGCAAGGGTCTCGCT
GCCCTGGGCTTGGAGTCCAAGCCCATCTCCTCGCTACGCCGTGATGTCTCTGCAGGTACT
GACATGGAAAAATTGAGCCTTATCCAAGTGGCAAGCCTGATAGAGTCATCAGCAAAGAAA
GGGATCACAGAACTCAGCCTCCGGGGGAAACTGGTCGACCAGATCGAGTGGCTCCCTGTT
TCACTCGGCAAATTGCAAGATGTTACCGAGCTTGATCTTTCCGAGAATAGGATCATGGCA
CTCCCATCAACAATTGGCAGCCTTAGATATTTGACAAAGCTTGACCTACACTCAAATCAG
CTGATCAATCTGCCCGACGCGTTTGGGGAACTCTCCAACCTAATTGATCTTGACCTGCAT
GCCAACCAGCTTAAGTCTCTTCCTTCATCATTTGGAAATCTCACGAGCCTAGCAAACCTT
GACCTGAGCTCAAATATGTTGAAGGCTCTTCCAGATTGTTTAGGAAAATTGGCAAACTTG
AGAAGATTAATTGTTGAGACAAATGAGCTTGAGGAGCTACCCTATACTATTGGATCTTGC
ACATCTCTTGTGGAGCTTAGGTTGGATTTCAATCAGTTAAAAGCCCTTCCAGAGGCCATT
GGGAAGTTGGAGAAGCTGGAAATACTGACATTGCACTATAACAGAATCAAAGGATTGCCT
ACAACAGTGGGTTCACTTTCCAGATTGAGAGAGCTGGATGTCAGTTTTAATGAGGTTGAA
GTAATCCCTGAGAACATTTGCTTTGCGACAAGTCTTGTGAAGTTGAATCTCAGCAGGAAT
TTTGCAGACTTAAGAGCACTGCCGAAATCAATAGGAAATCTTGAGATGCTAGAGGAGCTG
GACATAAGCAGTAACCAGATACGGGTACTGCCAGATTCGTTCAGGTGTCTTTCGAGGCTA
CGTGTATTTCATGCTGATGAGACTCCACTTGAATTTCCACCAAGAGAAGTTGTAAAGTTA
GGGGCTCAGGCTGTGGTCAAGTATATGAATGATTTGAATGCTGCAAGAGGAACAAACCAG
AAGAAAACAGATCGGGGAAGCTTCTGGACCTGGCTCTTCTCGCTGTTTGGTTGTTGCAAA
AAGAACCAAGAAGTGGGATTGCCAGTATAA

Protein

410 aa

>Os10t0572300-02 Similar to Protein lap4.
GYVGVGADSVDLEMELRKKEAAVAAAAAVAEMERGSKGLAALGLESKPISSLRRDVSAGT
DMEKLSLIQVASLIESSAKKGITELSLRGKLVDQIEWLPVSLGKLQDVTELDLSENRIMA
LPSTIGSLRYLTKLDLHSNQLINLPDAFGELSNLIDLDLHANQLKSLPSSFGNLTSLANL
DLSSNMLKALPDCLGKLANLRRLIVETNELEELPYTIGSCTSLVELRLDFNQLKALPEAI
GKLEKLEILTLHYNRIKGLPTTVGSLSRLRELDVSFNEVEVIPENICFATSLVKLNLSRN
FADLRALPKSIGNLEMLEELDISSNQIRVLPDSFRCLSRLRVFHADETPLEFPPREVVKL
GAQAVVKYMNDLNAARGTNQKKTDRGSFWTWLFSLFGCCKKNQEVGLPV*

5'UTR

chr10:22691246..22691246 (+ strand) : 1 bp

CDS

chr10:22691247..22691421 (+ strand) : 175 bp

chr10:22692403..22693316 (+ strand) : 914 bp

chr10:22693405..22693545 (+ strand) : 141 bp

3'UTR

chr10:22693546..22693784 (+ strand) : 239 bp

FASTA

>Os10t0572300-02 class=Sequence position=chr10:22691246..22693784 (+ strand)
TGGATACGTT GGTGTTGGTG CGGACAGCGT GGACCTGGAG ATGGAGCTGA GGAAGAAGGA GGCGGCGGTT GCGGCCGCGG
CCGCCGTCGC GGAGATGGAG CGCGGAAGCA AGGGTCTCGC TGCCCTGGGC TTGGAGTCCA AGCCCATCTC CTCGCTACGC
CGTGATGTCT CTGCAGGTAA TTTGCTTTCA AGTACAGTAT TATTTTGTCG GAATCACGAA ATCCTAAAAA TCTTTGTACT
ACTATATATC CATGTGTGAT GGTTTCGATG CTGCCGTGTT CTATGGACCC GACATAATTT TGCAGTATCT GTTTTTTTTT
CCGGTTAAAT TTCACTACCT TGCACGAATT GGATGCTCAT GTCATGCATA TGGGCGTAAT ATTTCCATTA CGATGTGGTT
GCTACCTTTT ATATAGAAAG AATCACTAGA AATAATTGTC AACTGACGTA ATGGCGTACT GATTTGTTAG TGTTGCTTTG
ATTTTCTTCA ACTAGTTGCC ATTTAATTGC ACACTGTTTA TAAATTGCCT ATTCTTGTTT CACTAGTACT ATAATTGGAA
ACATAGAGGA GCGGTCTCGT AGTTTGTGAT GATTCTGTAT TTCTGCTTGT TGGTTTAGCA AATTACACGA TTGATGTCTA
CAAGGTACCA GTGTACCGCA ACTGATTTTT CACCTTTCGC TATGAGTTAG CGTTTGATGT GAACAACCAC CTCTGCAGCC
AATTGTCACA TCACATCCAT TTCTTCAAAG GAATTTCGTG CTATTTTGTG ATTTCTTTTT TCTTGACATA ATGCATTAGT
CGTTTGTTGG TCCCAGCTTT AATTTTTAAT TTTCTTGCGG TAGTTGGAGG ACCATTCCCT TGTTGGTCAC TGCTGGACCT
GGTGTATCAT TTGTCTCTTG TGCCTGGTGA TCTGATATTG TTAATTCATT TGTTACCAGT TAGGCAATAG CATAATTATT
TGTCTGAATA CGATATGAAT CATGAGCAAT TAGTCATTTT GCTTTGTTGA CTTTGGAGGT GCTATCTAAT GTAGGCCTTA
ATCATGCTTA GGCAAGTAGT GATCATCAAA TTTGTAACGG TACCATAAAT GTGATCAGCA TTTTTGAGAT GTCAGTACTT
GTGTTATCCT AAGTTCCACT TGTCAATATC CCTGCAGGTA CTGACATGGA AAAATTGAGC CTTATCCAAG TGGCAAGCCT
GATAGAGTCA TCAGCAAAGA AAGGGATCAC AGAACTCAGC CTCCGGGGGA AACTGGTCGA CCAGATCGAG TGGCTCCCTG
TTTCACTCGG CAAATTGCAA GATGTTACCG AGCTTGATCT TTCCGAGAAT AGGATCATGG CACTCCCATC AACAATTGGC
AGCCTTAGAT ATTTGACAAA GCTTGACCTA CACTCAAATC AGCTGATCAA TCTGCCCGAC GCGTTTGGGG AACTCTCCAA
CCTAATTGAT CTTGACCTGC ATGCCAACCA GCTTAAGTCT CTTCCTTCAT CATTTGGAAA TCTCACGAGC CTAGCAAACC
TTGACCTGAG CTCAAATATG TTGAAGGCTC TTCCAGATTG TTTAGGAAAA TTGGCAAACT TGAGAAGATT AATTGTTGAG
ACAAATGAGC TTGAGGAGCT ACCCTATACT ATTGGATCTT GCACATCTCT TGTGGAGCTT AGGTTGGATT TCAATCAGTT
AAAAGCCCTT CCAGAGGCCA TTGGGAAGTT GGAGAAGCTG GAAATACTGA CATTGCACTA TAACAGAATC AAAGGATTGC
CTACAACAGT GGGTTCACTT TCCAGATTGA GAGAGCTGGA TGTCAGTTTT AATGAGGTTG AAGTAATCCC TGAGAACATT
TGCTTTGCGA CAAGTCTTGT GAAGTTGAAT CTCAGCAGGA ATTTTGCAGA CTTAAGAGCA CTGCCGAAAT CAATAGGAAA
TCTTGAGATG CTAGAGGAGC TGGACATAAG CAGTAACCAG ATACGGGTAC TGCCAGATTC GTTCAGGTGT CTTTCGAGGC
TACGTGTATT TCATGCTGAT GAGACTCCAC TTGAATTTCC ACCAAGAGAA GTTGTAAAGT TAGGGGCTCA GGTACACATT
ATACTGCCGT TCTGCCATAT TTGCTTACTT AGTCCTTCGC TTTCTTTAAA TGATTAACAA TGTTTCTTCT GCATGCCAGG
CTGTGGTCAA GTATATGAAT GATTTGAATG CTGCAAGAGG AACAAACCAG AAGAAAACAG ATCGGGGAAG CTTCTGGACC
TGGCTCTTCT CGCTGTTTGG TTGTTGCAAA AAGAACCAAG AAGTGGGATT GCCAGTATAA CTGAAGCATT TCATCATCTG
TATGTATGTT GTGAATTACT CAGGTCTGCA AAGAAAGGAA ACGTGGATAA TTTGGTTCCT CTTGTTTTTT TTGTCCCTTT
TTTTTGGTGT GTATATATGT AATTTTGTCA TGTAAGGTCC ATTTCTAGTT ATGCAAGACC TATTAAGATT CATTTCTGTG
TGTAACTTCA TTTGTATGAT AGCATGTTAC TGCTTCCATA TTAAAAACTG TCTTACAGC

Locus: Os10g0572300

Loading...

Locus: Os10g0572300

Loading...