Os10t0573900-01

Locus

Os10g0573900

Description

60S ribosomal subunit nuclear export adaptor, Ribosome assembly, Maintenance of normal protein synthesis efficiency, Plant development

RAP-DB Gene Symbol Synonym(s)

OsNMD3

RAP-DB Gene Name Synonym(s)

60S ribosomal subunit nuclear export adaptor NMD3

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNMD3, NMD3

Oryzabase Gene Name Synonym(s)

60S ribosomal subunit nuclear export adaptor NMD3

Transcript Evidence

AK101216

AK060642

Protein Evidence

Q336P7

Literature

PMID: 24723395

Note

Manual Curation

July 27, 2020

Functional domain (InterPro)

Nmd3, N-terminal (IPR007064)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Full-length cDNA

J033031B21 (Online Clone Ordering)

001-027-F06 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0573900-01)

RiceXPro (AK101216)

Others

Oryzabase (18094)

KEGG (Os10t0573900-01)

Transcript

2005 bp

>Os10t0573900-01 60S ribosomal subunit nuclear export adaptor, Ribosome assembly, Maintenance of normal protein synthesis efficiency, Plant development
GAGATCCCCCAATCCACTCGATTCGATCCAATCCGGCGAGGTACAGGATGCTGCCGGGGT
CGGCGGCGCCGGCGGCTGGGAGCGGCATGTTCGTGCCAACGCAGACGGTGGGCACGGTGC
TGTGCTGCATCTGCGGCGTGGCGATGCAGCCCAACCCGGCCAACATGTGCGCGCGCTGCA
TCCGCGCCCGCGTCGACATCACCGAGGGCGTCCCGCGCCACGCCGCCGTCGTCTACTGCC
CCGACTGCACCTCCTACCTCCAGCCGCCGCGCTCCTGGCTCCGCGCCGGCCCGGAGTCCC
CCGAGCTCATGCAGATCCTCCTCCGCCGCCTCAACCGCCCCCTCGCCCGCCTCCGCGTCT
CCCTCTCCGCCGCCGAGTTCGTCTTCTCCGAGCCCCACTCCAAGCGCCTCCGCCTCAAGC
TCCGCCTCCGCCGCGAGGTCTTCAACGCCGTCGTCCTCGAGCAGACCCACCCCGTCGAGT
TCACCGTCCACGATCGCCTCTGCGATGCCTGCGCCCGCGCCCAGTCCAACCCCGACCAGT
GGGTCGCCGTCGTCCAGCTCCGCCAGCACGTCCCGCACCGCCGCACCTTCCTCTACCTCG
AGCAGCTCCTCCTCAAGCACGGCCAGGCCTCCCTCGCCCTCCGCGTCGCCGCCGCCCCCG
GCGGCCTCGACTTCTTCTTCGGCTCCCGCTCGCACGCCGCCCGCCTCGTCGACTTCCTCG
CCACCGTCGCCCCCGTCCAGACCCAGACCGCCAAGCAGCTCGTCTCCCACGACACCAAGA
GCAACGTCTACAACTACAAGCACACCTTCTCCGTCGAGATCTGCCCCATCTGCCGGGAGG
ACCTCATCGCCCTTAGCCCTCAGGTGTCCCGCGATCTTGGAGGCCTTGGACCTATCGTCC
TCTGCATCAAGGTCACCAATGCCATCGCTCTGCTTGACCCCCTCACCCTGCGTGTGCACC
ACCTCGAGGAAAAGAAGTACAGGGTCTACAACTTCAAGGCTGCTCTCACCAGCAAGCAGC
TCGTCGAGTACATCGTGCTAGACATCGAGCACGAGTCACCAGAGATTACCATTGACGGAT
CTCGCTACCAGTTGGCTTATGCCCAGGTCGCCCGGGTCTCCGACTTTGGGAAAAACGACA
CCATGTTCACCGTGCGGACTCATCTTGGCCACCTGCTGAATCCTGGAGACCTTGCCCTTG
GGTATGATCTTTATGGTGCCAACTTGAATGATGATGACATGGACACAGCTATGATGCGCC
ACAGTCTGCCTGAAGTCATTCTTGTTAAGAAGAGCTTCGCCAAGAGGCCACGCACACGCC
GATGGAAGCTGAAGAGGCTTCCAATGGAGGAAGATGCTGTAAATAAGGCCAAGGGGGAGC
TAGAGAAGAGGGCTGATGAGTATGAGGAGTTTCTCAGGGACTTGGAGCACAACTCTGATA
TTAGATTCCAGATTGATCTATACAAGGATGAGGACTACAGGTCGGAGATGGCATCTACTA
TTGGTGATGATGTTCCCACTGTGCCGATTGAGGAACTAATTGAGGACCTAAGTCTTGGTG
ATGATGAGGAGGAGGATGAAGGTGGGGAAGGCAACCAACATGCTGTTATGGTGGGATGAG
TTAATATGTTTACCTGTGCTGTGCTTCTGCCTTCTGGTGATGGTTGCTGCCAACCGCAGA
TCATAGGTCTGAACTGCATCTGTTTAATCCGTATAAGTTTTGTTCTCCCCTTTACTTCTA
TAAGTTATAAGTTTTGTTGCTAAATTGTTTCAACTTTTGCTGTTTCTCATGATAGATGTT
GTATCACCTTATCCTGTATCTGGTGTTGCAGCTTGGCTTAAATTATATTTCTCTATTCTT
ATTGTCTGTGATATGTTGTTTTCTTGCCATAGTGTGGCTGATCACAACATATCTTAAAAT
AGATGCATTGTTTGATTTCCAAAACATCTAGTTTGGTGTTTAGATTGTGCCAGATTCATA
TTTTTACTATATGTTTTTAGTCCCC

CDS

1572 bp

>Os10t0573900-01 60S ribosomal subunit nuclear export adaptor, Ribosome assembly, Maintenance of normal protein synthesis efficiency, Plant development
ATGCTGCCGGGGTCGGCGGCGCCGGCGGCTGGGAGCGGCATGTTCGTGCCAACGCAGACG
GTGGGCACGGTGCTGTGCTGCATCTGCGGCGTGGCGATGCAGCCCAACCCGGCCAACATG
TGCGCGCGCTGCATCCGCGCCCGCGTCGACATCACCGAGGGCGTCCCGCGCCACGCCGCC
GTCGTCTACTGCCCCGACTGCACCTCCTACCTCCAGCCGCCGCGCTCCTGGCTCCGCGCC
GGCCCGGAGTCCCCCGAGCTCATGCAGATCCTCCTCCGCCGCCTCAACCGCCCCCTCGCC
CGCCTCCGCGTCTCCCTCTCCGCCGCCGAGTTCGTCTTCTCCGAGCCCCACTCCAAGCGC
CTCCGCCTCAAGCTCCGCCTCCGCCGCGAGGTCTTCAACGCCGTCGTCCTCGAGCAGACC
CACCCCGTCGAGTTCACCGTCCACGATCGCCTCTGCGATGCCTGCGCCCGCGCCCAGTCC
AACCCCGACCAGTGGGTCGCCGTCGTCCAGCTCCGCCAGCACGTCCCGCACCGCCGCACC
TTCCTCTACCTCGAGCAGCTCCTCCTCAAGCACGGCCAGGCCTCCCTCGCCCTCCGCGTC
GCCGCCGCCCCCGGCGGCCTCGACTTCTTCTTCGGCTCCCGCTCGCACGCCGCCCGCCTC
GTCGACTTCCTCGCCACCGTCGCCCCCGTCCAGACCCAGACCGCCAAGCAGCTCGTCTCC
CACGACACCAAGAGCAACGTCTACAACTACAAGCACACCTTCTCCGTCGAGATCTGCCCC
ATCTGCCGGGAGGACCTCATCGCCCTTAGCCCTCAGGTGTCCCGCGATCTTGGAGGCCTT
GGACCTATCGTCCTCTGCATCAAGGTCACCAATGCCATCGCTCTGCTTGACCCCCTCACC
CTGCGTGTGCACCACCTCGAGGAAAAGAAGTACAGGGTCTACAACTTCAAGGCTGCTCTC
ACCAGCAAGCAGCTCGTCGAGTACATCGTGCTAGACATCGAGCACGAGTCACCAGAGATT
ACCATTGACGGATCTCGCTACCAGTTGGCTTATGCCCAGGTCGCCCGGGTCTCCGACTTT
GGGAAAAACGACACCATGTTCACCGTGCGGACTCATCTTGGCCACCTGCTGAATCCTGGA
GACCTTGCCCTTGGGTATGATCTTTATGGTGCCAACTTGAATGATGATGACATGGACACA
GCTATGATGCGCCACAGTCTGCCTGAAGTCATTCTTGTTAAGAAGAGCTTCGCCAAGAGG
CCACGCACACGCCGATGGAAGCTGAAGAGGCTTCCAATGGAGGAAGATGCTGTAAATAAG
GCCAAGGGGGAGCTAGAGAAGAGGGCTGATGAGTATGAGGAGTTTCTCAGGGACTTGGAG
CACAACTCTGATATTAGATTCCAGATTGATCTATACAAGGATGAGGACTACAGGTCGGAG
ATGGCATCTACTATTGGTGATGATGTTCCCACTGTGCCGATTGAGGAACTAATTGAGGAC
CTAAGTCTTGGTGATGATGAGGAGGAGGATGAAGGTGGGGAAGGCAACCAACATGCTGTT
ATGGTGGGATGA

Protein

524 aa

>Os10t0573900-01 60S ribosomal subunit nuclear export adaptor, Ribosome assembly, Maintenance of normal protein synthesis efficiency, Plant development
MLPGSAAPAAGSGMFVPTQTVGTVLCCICGVAMQPNPANMCARCIRARVDITEGVPRHAA
VVYCPDCTSYLQPPRSWLRAGPESPELMQILLRRLNRPLARLRVSLSAAEFVFSEPHSKR
LRLKLRLRREVFNAVVLEQTHPVEFTVHDRLCDACARAQSNPDQWVAVVQLRQHVPHRRT
FLYLEQLLLKHGQASLALRVAAAPGGLDFFFGSRSHAARLVDFLATVAPVQTQTAKQLVS
HDTKSNVYNYKHTFSVEICPICREDLIALSPQVSRDLGGLGPIVLCIKVTNAIALLDPLT
LRVHHLEEKKYRVYNFKAALTSKQLVEYIVLDIEHESPEITIDGSRYQLAYAQVARVSDF
GKNDTMFTVRTHLGHLLNPGDLALGYDLYGANLNDDDMDTAMMRHSLPEVILVKKSFAKR
PRTRRWKLKRLPMEEDAVNKAKGELEKRADEYEEFLRDLEHNSDIRFQIDLYKDEDYRSE
MASTIGDDVPTVPIEELIEDLSLGDDEEEDEGGEGNQHAVMVG*

5'UTR

chr10:22784312..22784358 (- strand) : 47 bp

CDS

chr10:22782740..22784311 (- strand) : 1572 bp

3'UTR

chr10:22782354..22782739 (- strand) : 386 bp

FASTA

>Os10t0573900-01 class=Sequence position=chr10:22782354..22784358 (- strand)
GAGATCCCCC AATCCACTCG ATTCGATCCA ATCCGGCGAG GTACAGGATG CTGCCGGGGT CGGCGGCGCC GGCGGCTGGG
AGCGGCATGT TCGTGCCAAC GCAGACGGTG GGCACGGTGC TGTGCTGCAT CTGCGGCGTG GCGATGCAGC CCAACCCGGC
CAACATGTGC GCGCGCTGCA TCCGCGCCCG CGTCGACATC ACCGAGGGCG TCCCGCGCCA CGCCGCCGTC GTCTACTGCC
CCGACTGCAC CTCCTACCTC CAGCCGCCGC GCTCCTGGCT CCGCGCCGGC CCGGAGTCCC CCGAGCTCAT GCAGATCCTC
CTCCGCCGCC TCAACCGCCC CCTCGCCCGC CTCCGCGTCT CCCTCTCCGC CGCCGAGTTC GTCTTCTCCG AGCCCCACTC
CAAGCGCCTC CGCCTCAAGC TCCGCCTCCG CCGCGAGGTC TTCAACGCCG TCGTCCTCGA GCAGACCCAC CCCGTCGAGT
TCACCGTCCA CGATCGCCTC TGCGATGCCT GCGCCCGCGC CCAGTCCAAC CCCGACCAGT GGGTCGCCGT CGTCCAGCTC
CGCCAGCACG TCCCGCACCG CCGCACCTTC CTCTACCTCG AGCAGCTCCT CCTCAAGCAC GGCCAGGCCT CCCTCGCCCT
CCGCGTCGCC GCCGCCCCCG GCGGCCTCGA CTTCTTCTTC GGCTCCCGCT CGCACGCCGC CCGCCTCGTC GACTTCCTCG
CCACCGTCGC CCCCGTCCAG ACCCAGACCG CCAAGCAGCT CGTCTCCCAC GACACCAAGA GCAACGTCTA CAACTACAAG
CACACCTTCT CCGTCGAGAT CTGCCCCATC TGCCGGGAGG ACCTCATCGC CCTTAGCCCT CAGGTGTCCC GCGATCTTGG
AGGCCTTGGA CCTATCGTCC TCTGCATCAA GGTCACCAAT GCCATCGCTC TGCTTGACCC CCTCACCCTG CGTGTGCACC
ACCTCGAGGA AAAGAAGTAC AGGGTCTACA ACTTCAAGGC TGCTCTCACC AGCAAGCAGC TCGTCGAGTA CATCGTGCTA
GACATCGAGC ACGAGTCACC AGAGATTACC ATTGACGGAT CTCGCTACCA GTTGGCTTAT GCCCAGGTCG CCCGGGTCTC
CGACTTTGGG AAAAACGACA CCATGTTCAC CGTGCGGACT CATCTTGGCC ACCTGCTGAA TCCTGGAGAC CTTGCCCTTG
GGTATGATCT TTATGGTGCC AACTTGAATG ATGATGACAT GGACACAGCT ATGATGCGCC ACAGTCTGCC TGAAGTCATT
CTTGTTAAGA AGAGCTTCGC CAAGAGGCCA CGCACACGCC GATGGAAGCT GAAGAGGCTT CCAATGGAGG AAGATGCTGT
AAATAAGGCC AAGGGGGAGC TAGAGAAGAG GGCTGATGAG TATGAGGAGT TTCTCAGGGA CTTGGAGCAC AACTCTGATA
TTAGATTCCA GATTGATCTA TACAAGGATG AGGACTACAG GTCGGAGATG GCATCTACTA TTGGTGATGA TGTTCCCACT
GTGCCGATTG AGGAACTAAT TGAGGACCTA AGTCTTGGTG ATGATGAGGA GGAGGATGAA GGTGGGGAAG GCAACCAACA
TGCTGTTATG GTGGGATGAG TTAATATGTT TACCTGTGCT GTGCTTCTGC CTTCTGGTGA TGGTTGCTGC CAACCGCAGA
TCATAGGTCT GAACTGCATC TGTTTAATCC GTATAAGTTT TGTTCTCCCC TTTACTTCTA TAAGTTATAA GTTTTGTTGC
TAAATTGTTT CAACTTTTGC TGTTTCTCAT GATAGATGTT GTATCACCTT ATCCTGTATC TGGTGTTGCA GCTTGGCTTA
AATTATATTT CTCTATTCTT ATTGTCTGTG ATATGTTGTT TTCTTGCCAT AGTGTGGCTG ATCACAACAT ATCTTAAAAT
AGATGCATTG TTTGATTTCC AAAACATCTA GTTTGGTGTT TAGATTGTGC CAGATTCATA TTTTTACTAT ATGTTTTTAG
TCCCC

Locus: Os10g0573900

Loading...

Locus: Os10g0573900

Loading...