Os10t0573900-03

Locus

Os10g0573900

Description

Similar to Nonsense-mediated mRNA decay protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNMD3, NMD3

Oryzabase Gene Name Synonym(s)

60S ribosomal subunit nuclear export adaptor NMD3

Transcript Evidence

AK073206 (DDBJ, Best hit)

Protein Evidence

B6SSZ8 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J033004L13 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0573900-03)

RiceXPro (AK073206)

Others

Oryzabase (18094)

KEGG (Os10t0573900-03)

Transcript

1462 bp

>Os10t0573900-03 Similar to Nonsense-mediated mRNA decay protein 3.
GAAAAGAAGTACAGGGTCTACAACTTCAAGGCTGCTCTCACCAGCAAGCAGCTCGTCGAG
TACATCGTGCTAGACATCGAGCACGAGTCACCAGAGATTACCATTGACGGATCTCGCTAC
CAGTTGGCTTATGCCCAGGTCGCCCGGGTCTCCGACTTTGGGAAAAACGACACCATGTTC
ACCGTGCGGACTCATCTTGGCCACCTGCTGAATCCTGGAGACCTTGCCCTTGGGTATGAT
CTTTATGGTGCCAACTTGAATGATGATGACATGGACACAGCTATGATGCGCCACAGTCTG
CCTGAAGTCATTCTTGTTAAGAAGAGCTTCGCCAAGAGGCCACGCACACGCCGATGGAAG
CTGAAGAGGCTTCCAATGGAGGAAGATGCTGTAAATAAGGCCAAGGGGGAGCTAGAGAAG
AGGGCTGATGAGTATGAGGAGTTTCTCAGGGACTTGGAGCACAACTCTGATATTAGATTC
CAGATTGATCTATACAAGGATGAGGACTACAGGTCGGAGATGGCATCTACTATTGGTGAT
GATGTTCCCACTGTGCCGATTGAGGAACTAATTGAGGACCTAAGTCTTGGTGATGATGAG
GAGGAGGATGAAGGTGGGGAAGGCAACCAACATGCTGTTATGGTGGGATGAGTTAATATG
TTTACCTGTGCTGTGCTTCTGCCTTCTGGTGATGGTTGCTGCCAACCGCAGATCATAGGT
CTGAACTGCATCTGTTTAATCCGTATAAGTTTTGTTCTCCCCTTTACTTCTATAAGTTAT
AAGTTTTGTTGCTAAATTGTTTCAACTTTTGCTGTTTCTCATGATAGATGTTGTATCACC
TTATCCTGTATCTGGTGTTGCAGCTTGGCTTAAATTATATTTCTCTATTCTTATTGTCTG
TGATATGTTGTTTTCTTGCCATAGTGTGGCTGATCACAACATATCTTAAAATAGATGCAT
TGTTTGATTTCCAAAACATCTAGTTTGGTGTTTAGATTGTGCCAGATTCATATTTTTACT
ATATGTTTTTAGTCCCCATTATGTGGTTTGCAAGCGTGGAATATGATTGTGGATTTATGC
TGAGTCATGACTAGAGAATTGTAGGTATGACCTGAAAACGTCTGCCATGTTGAGTGTCAC
TCCAATAAATTGATTAAAAAACTAATAAAGATAAGTGTAGTATAATATCATACCCAGGAG
CCATGATGAGACAATAATGTGCATTTTTAGTGATTGCAATTCAACTGCTGCTGTTTTATC
AGGCACTTCATTCAGACTATGCCTACATCGTGCAATAAGAGGTTAGATATGTAGAGTTGA
TGGACAGAACAGATGGTGCTCCACTAATAAGCGATGAGTACTGGTTTGGTAAAACTTTAA
TAAGTTAAGAATTTTACGGATCTTTTTTTTCTATTACTTTCACAAGGTGGTGCTGTTCTC
AAACCTAATGACTTATAATCGT

CDS

651 bp

>Os10t0573900-03 Similar to Nonsense-mediated mRNA decay protein 3.
GAAAAGAAGTACAGGGTCTACAACTTCAAGGCTGCTCTCACCAGCAAGCAGCTCGTCGAG
TACATCGTGCTAGACATCGAGCACGAGTCACCAGAGATTACCATTGACGGATCTCGCTAC
CAGTTGGCTTATGCCCAGGTCGCCCGGGTCTCCGACTTTGGGAAAAACGACACCATGTTC
ACCGTGCGGACTCATCTTGGCCACCTGCTGAATCCTGGAGACCTTGCCCTTGGGTATGAT
CTTTATGGTGCCAACTTGAATGATGATGACATGGACACAGCTATGATGCGCCACAGTCTG
CCTGAAGTCATTCTTGTTAAGAAGAGCTTCGCCAAGAGGCCACGCACACGCCGATGGAAG
CTGAAGAGGCTTCCAATGGAGGAAGATGCTGTAAATAAGGCCAAGGGGGAGCTAGAGAAG
AGGGCTGATGAGTATGAGGAGTTTCTCAGGGACTTGGAGCACAACTCTGATATTAGATTC
CAGATTGATCTATACAAGGATGAGGACTACAGGTCGGAGATGGCATCTACTATTGGTGAT
GATGTTCCCACTGTGCCGATTGAGGAACTAATTGAGGACCTAAGTCTTGGTGATGATGAG
GAGGAGGATGAAGGTGGGGAAGGCAACCAACATGCTGTTATGGTGGGATGA

Protein

217 aa

>Os10t0573900-03 Similar to Nonsense-mediated mRNA decay protein 3.
EKKYRVYNFKAALTSKQLVEYIVLDIEHESPEITIDGSRYQLAYAQVARVSDFGKNDTMF
TVRTHLGHLLNPGDLALGYDLYGANLNDDDMDTAMMRHSLPEVILVKKSFAKRPRTRRWK
LKRLPMEEDAVNKAKGELEKRADEYEEFLRDLEHNSDIRFQIDLYKDEDYRSEMASTIGD
DVPTVPIEELIEDLSLGDDEEEDEGGEGNQHAVMVG*

CDS

chr10:22782740..22783390 (- strand) : 651 bp

3'UTR

chr10:22781929..22782739 (- strand) : 811 bp

FASTA

>Os10t0573900-03 class=Sequence position=chr10:22781929..22783390 (- strand)
GAAAAGAAGT ACAGGGTCTA CAACTTCAAG GCTGCTCTCA CCAGCAAGCA GCTCGTCGAG TACATCGTGC TAGACATCGA
GCACGAGTCA CCAGAGATTA CCATTGACGG ATCTCGCTAC CAGTTGGCTT ATGCCCAGGT CGCCCGGGTC TCCGACTTTG
GGAAAAACGA CACCATGTTC ACCGTGCGGA CTCATCTTGG CCACCTGCTG AATCCTGGAG ACCTTGCCCT TGGGTATGAT
CTTTATGGTG CCAACTTGAA TGATGATGAC ATGGACACAG CTATGATGCG CCACAGTCTG CCTGAAGTCA TTCTTGTTAA
GAAGAGCTTC GCCAAGAGGC CACGCACACG CCGATGGAAG CTGAAGAGGC TTCCAATGGA GGAAGATGCT GTAAATAAGG
CCAAGGGGGA GCTAGAGAAG AGGGCTGATG AGTATGAGGA GTTTCTCAGG GACTTGGAGC ACAACTCTGA TATTAGATTC
CAGATTGATC TATACAAGGA TGAGGACTAC AGGTCGGAGA TGGCATCTAC TATTGGTGAT GATGTTCCCA CTGTGCCGAT
TGAGGAACTA ATTGAGGACC TAAGTCTTGG TGATGATGAG GAGGAGGATG AAGGTGGGGA AGGCAACCAA CATGCTGTTA
TGGTGGGATG AGTTAATATG TTTACCTGTG CTGTGCTTCT GCCTTCTGGT GATGGTTGCT GCCAACCGCA GATCATAGGT
CTGAACTGCA TCTGTTTAAT CCGTATAAGT TTTGTTCTCC CCTTTACTTC TATAAGTTAT AAGTTTTGTT GCTAAATTGT
TTCAACTTTT GCTGTTTCTC ATGATAGATG TTGTATCACC TTATCCTGTA TCTGGTGTTG CAGCTTGGCT TAAATTATAT
TTCTCTATTC TTATTGTCTG TGATATGTTG TTTTCTTGCC ATAGTGTGGC TGATCACAAC ATATCTTAAA ATAGATGCAT
TGTTTGATTT CCAAAACATC TAGTTTGGTG TTTAGATTGT GCCAGATTCA TATTTTTACT ATATGTTTTT AGTCCCCATT
ATGTGGTTTG CAAGCGTGGA ATATGATTGT GGATTTATGC TGAGTCATGA CTAGAGAATT GTAGGTATGA CCTGAAAACG
TCTGCCATGT TGAGTGTCAC TCCAATAAAT TGATTAAAAA ACTAATAAAG ATAAGTGTAG TATAATATCA TACCCAGGAG
CCATGATGAG ACAATAATGT GCATTTTTAG TGATTGCAAT TCAACTGCTG CTGTTTTATC AGGCACTTCA TTCAGACTAT
GCCTACATCG TGCAATAAGA GGTTAGATAT GTAGAGTTGA TGGACAGAAC AGATGGTGCT CCACTAATAA GCGATGAGTA
CTGGTTTGGT AAAACTTTAA TAAGTTAAGA ATTTTACGGA TCTTTTTTTT CTATTACTTT CACAAGGTGG TGCTGTTCTC
AAACCTAATG ACTTATAATC GT

Locus: Os10g0573900

Loading...

Locus: Os10g0573900

Loading...