Os10t0575600-01

Locus

Os10g0575600

Description

Homeodomain-related containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ROC3

CGSNL Gene Name

RICE OUTMOST CELL-SPECIFIC GENE 3

Oryzabase Gene Symbol Synonym(s)

Roc3(t), Roc3, GL2-3

Oryzabase Gene Name Synonym(s)

Rice outmost cell-specific gene 3(t), Rice outermost cell-specific gene-3, Homeobox-leucine zipper protein ROC3, Homeodomain transcription factor ROC3, HD-ZIP protein ROC3, Protein RICE OUTERMOST CELL-SPECIFIC 3, GLABR 2-like homeobox protein 3

Transcript Evidence

AK071939 (DDBJ, Best hit)

Protein Evidence

Q336P2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeobox (IPR001356)

Lipid-binding START (IPR002913)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Homeobox, conserved site (IPR017970)

START-like domain (IPR023393)

Full-length cDNA

J013087I01 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0575600-01)

RiceXPro (AK071939)

Others

Oryzabase (2864)

KEGG (Os10t0575600-01)

Transcript

3741 bp

>Os10t0575600-01 Homeodomain-related containing protein.
GGTTACTCCTCTTCCTCGCTCGCTCGCTCGCTGCCTTAGCCTTGACCTCCATCGATATTG
CAACCATAAAGAGGAGGAGGAAGAGGAGGCGAGAAAGAGAGAGAGATCGTCTTCTTCTCC
AGCCAGCCAGCCAGCCGTGATTGATCTCAAGGGGGAAGGCAGCTGCAGGGATCAAGAAGA
AGGAGAAGAAGTGATCAAGGAAGGAAGGCCACGGAACAACCGACAGGGCAGGAGGGCGCT
GGCCGGATCGCCGGAGAAGGAACCACTAGCTAGCTAGCTAGCTACTCCTATTGAAGATAT
CGCCGGCCGGACATATGCGCAGGATGTTCGGGGACTGCCAGGTCCTGTCGtccatggccg
ccatggccggggccgcctcctccgccgacgcgctcttcgcctcgccgctcatccccAACC
CCGCTCTCGCCGGCTTCATGTCCTCCTCCGCCGCCATGCCCTTCCACCACTTCTCCAACG
CCGCCGCCACCTTAATACCTAAGGAGGAGGGGTTGATGGGCGGCCTCCATGTGGCCAAGG
ACGAGGGGATGGACCTCGAGATGGACATGGAGCTCAGTGGCGGCTCCGGCAGCGCCCACC
TCGACGGCCTCCTCAGCTTCGCCGACGTCGACGACGACCACAAGCCGCAGCACAGCGGCC
ATGACCAGCCGCCCGACGCCGCCCAGCCCAGCGGCGCCGCGGGGGGCAACGCCAAGAAGA
AGCGCTACCACCGCCACACGGCGCACCAGATCCAGCAGATGGAGGCGCTGTTCAAGGAGT
GCCCGCATCCGGACGACAAGCAGCGGCTGAAGCTGAGCCAGGAACTGGGCCTCAAACCTC
GCCAGGTCAAGTTCTGGTTCCAGAATCGCCGGACCCAGATGAAGGCGCAGCAGGACAGGG
CGGACAACGTGATTCTGCGCGCGGAGAACGAGAACCTCAAGAGCGACAACTTCCGCCTCC
AGGCCGCCATCCGCAACGTCGTCTGCCCCAACTGCGGCCACGCCGCCGTCCTCGCCGACA
TGTCCTACGAGGAGCAGCAGCTCCGCATCGAGAACGCCAGGCTCAAAGACGAGCTTGACC
GCTTGGCCTGCATCGCCACCCGCTACGGCGGCGGCGGCGGACGGCAGCCGGTGCTGTCGA
CGTCGGCCCTGAGCTGCATCTCGGCGCCGCCGCCGGTCCTCATGCCACCGCTCGACCTCG
ACATGAACGTCTACTCGCGGCACTTCGCCGAGCAGGCGCCGGTCATGGGCTGCGGCGACC
TCATCCCGCCACCCGTCGTGCCGCAGCACGATGGCGCGGCGGCGTACATGGGCGCCATGA
TGGCGCCCGTGCAGGAGCAGGACAAGCAGCTGGTGGTCGACCTCGCCGCCACGGCGGCGG
ACCAGCTCGCCAGGATGTGCCGCGCCGGCGAGCCGCTGTGGGTGCGGCAGCGTGGCGCGG
AGGTGATGGCCGTGGAGGAGCACGCGCGGATGTTCAGCTGGCCGGTGGACGGCGCGAAGC
AGGGAGACGGCGGCGCGGTGGCGAGGGCGGAGGGGACGCGTGACAACGCGGTGGTCATCA
TGAACAGCATCAACTTGGTGGACGCCTTCCTCGATGCGAACAAATGGATGGAGCTGTTCC
CGTCGATTGTTTGCAAGGCAAGAACAATCCAGATCATAAACCACGGAGCTGCGTCTGGTC
ACCTCGGCAGTGGAACTCTCCTCTTGATGCAAGCAGAGGTGCAGTTCTTGTCGCCTCTGG
TGGCGGCGCGCGAGGTGGTGTTCTTCCGTTACTGCGTGCACAACGCCGACGAGGGGAGCT
GGGCGATCGTGGATTTCCCGGCGGAAGGGTTTGAGGAGGGGCTCCTCCAAGCCTCGGTGG
TCAGGTGCCGGCGGCGGCCGTCCGGCTGCATCATCCAGGACATGCCCAATGGATACTCCA
GGGTGGTGTGGGTGGAGCACATGGAGATGGTCGGGGAGGAGAAGCCGCTGCAGCCGGTGT
TCAGGGACTACGTCGCCAGCGGCGCCGCCTTCGGGGCCACGCGCTGGCTCTCCATCCTCC
AGCGCCAGTGCGAGCGCCTCGCCAGTGAGCTCGCCCGTAACATCGCCGACCTCGGAGTGA
TCCGCACCCCTGAGGCAAGAACAAATATGATGAAGCTGTCGCAGCGGATGATCACCACTT
TCTGTGCTAACATCAGTGCTTCTGGAACCCAATCTTGGACGGCCCTCTCGGATTCAACCC
AGGACACTATCAGGGTTACAACTCGGAAGAACACTGAGCCCGGACAGCCCAGCGGTGTCA
TCCTCACCGCTGTCTCCACAAGCTGGCTTCCTTTTACCCATCAGCAGGTGTTTGAGCTTC
TTGCAGATGAACAACAGCGCTGCCAGCTTGAGATTTTGTCAAACGGCGGCTCCCTTCATG
AGGTGGCACATATTGCAAATGGATCACATCCAAGGAATTGCATCTCTCTTCTTCGCATTA
ACGCTGCAAGCAACTCGTCACAGAATGTGGAGCTCCTGCTGCAGGAGAGCAGCACCCACC
CTGATGGTGGGAGCCTGGTGGTGTTCGCGACGGTGGACGTGGACGCAATTCAGGTGACGA
TGAGCGGCGAGGATCCTTCCTACATCCCTCTCCTCCCCCTGGGCTTCGCCATCTTCCCTG
CCACCAGCCCATCACCTGCTGCTGCACCCACCATCAGCTCAAGCACCACCACCACCACTG
GCAATGGCAATGGCGAAACCAGTAGCACTCCTCCAAGAAACAGCAGCAGCAACAACAACA
ATGCAGATGAGCTGCTGCCTCCCAATGGCTGCCTCCTCACCGTCGGCATGCAGGTGCTGG
CCAGCGCCGTACCTTCTGCCAAGCTCAACCTCTCGAGTGTCACTGCGATCAACAGCCATG
TCTGCAACGCCATTCACCAGATCACAGCTGCACTCAAAAGTTCAGCAGGTGGTGCTGGGG
GTGAGCCGGCGTCCGATCAGTAGCAAAGGAGACCTGGAGGAGAGGGGATCGGAGCAACAT
GGGATCAGACACCAAAATGCCTCCCAATTTATTTCGCTAACATCGCAGTTTGTTTTTCTG
TTAGCTCTCGGTCTGGCTGGTTCATCAGGTGCAAGGGAGGGTTTGACAAGAAGCCAACAC
TAACAGCTACTCAAATCTCTCCTCTCTTCCCGCCATATTTCTGCCTCTCAAAATGACGAA
AATACCCCCAACCAGCCAACAAGCAAAGCCATGGGGGGCATTTTGATCATTTTGGGAAGC
TACTTCTGCTGAGAAAGAAAGAAAGAAAGAAAGGGTCTTGTCAAGCTCTCACTTGCACCA
ACCAGCTGATTCATGAATTTGCTGACATCAGCTCTGCAGGCATTTTGGTCGTGCATCGGT
TTCTTGCTACTCCATCCATCCCTCTTTAGGTTCTTCCTCCCTTTCCTCATCAAAAGTGAG
AACTGCATGTGAAGAAGGTTAGCTCCTTGTTTTGAATTTTTGTAATAATAAGATGGAAGA
AGAAGACTTGGTAGCTTGAGTGTGTGGTTTGTGTTAAGATCGAGCTAGACTTTGTGTAAG
GTTGAAGAAGAAGAAGACATTAAGCAGATTGTTATTAGGAGATGAGATAAGAGAAAGGAG
GAGAGGAGAAGTCAAGAGCGAACCAGTTGTGACCCTTCTTCACACTAGAAGGGGGTCTTG
GTTCGGGAATTGACTTGTTACCTCTCTGCACTCTTTGTCTGTAACCTTTGCCCTATCTTA
TTATTACTACTAGTATTGTTC

CDS

2649 bp

>Os10t0575600-01 Homeodomain-related containing protein.
ATGCGCAGGATGTTCGGGGACTGCCAGGTCCTGTCGtccatggccgccatggccggggcc
gcctcctccgccgacgcgctcttcgcctcgccgctcatccccAACCCCGCTCTCGCCGGC
TTCATGTCCTCCTCCGCCGCCATGCCCTTCCACCACTTCTCCAACGCCGCCGCCACCTTA
ATACCTAAGGAGGAGGGGTTGATGGGCGGCCTCCATGTGGCCAAGGACGAGGGGATGGAC
CTCGAGATGGACATGGAGCTCAGTGGCGGCTCCGGCAGCGCCCACCTCGACGGCCTCCTC
AGCTTCGCCGACGTCGACGACGACCACAAGCCGCAGCACAGCGGCCATGACCAGCCGCCC
GACGCCGCCCAGCCCAGCGGCGCCGCGGGGGGCAACGCCAAGAAGAAGCGCTACCACCGC
CACACGGCGCACCAGATCCAGCAGATGGAGGCGCTGTTCAAGGAGTGCCCGCATCCGGAC
GACAAGCAGCGGCTGAAGCTGAGCCAGGAACTGGGCCTCAAACCTCGCCAGGTCAAGTTC
TGGTTCCAGAATCGCCGGACCCAGATGAAGGCGCAGCAGGACAGGGCGGACAACGTGATT
CTGCGCGCGGAGAACGAGAACCTCAAGAGCGACAACTTCCGCCTCCAGGCCGCCATCCGC
AACGTCGTCTGCCCCAACTGCGGCCACGCCGCCGTCCTCGCCGACATGTCCTACGAGGAG
CAGCAGCTCCGCATCGAGAACGCCAGGCTCAAAGACGAGCTTGACCGCTTGGCCTGCATC
GCCACCCGCTACGGCGGCGGCGGCGGACGGCAGCCGGTGCTGTCGACGTCGGCCCTGAGC
TGCATCTCGGCGCCGCCGCCGGTCCTCATGCCACCGCTCGACCTCGACATGAACGTCTAC
TCGCGGCACTTCGCCGAGCAGGCGCCGGTCATGGGCTGCGGCGACCTCATCCCGCCACCC
GTCGTGCCGCAGCACGATGGCGCGGCGGCGTACATGGGCGCCATGATGGCGCCCGTGCAG
GAGCAGGACAAGCAGCTGGTGGTCGACCTCGCCGCCACGGCGGCGGACCAGCTCGCCAGG
ATGTGCCGCGCCGGCGAGCCGCTGTGGGTGCGGCAGCGTGGCGCGGAGGTGATGGCCGTG
GAGGAGCACGCGCGGATGTTCAGCTGGCCGGTGGACGGCGCGAAGCAGGGAGACGGCGGC
GCGGTGGCGAGGGCGGAGGGGACGCGTGACAACGCGGTGGTCATCATGAACAGCATCAAC
TTGGTGGACGCCTTCCTCGATGCGAACAAATGGATGGAGCTGTTCCCGTCGATTGTTTGC
AAGGCAAGAACAATCCAGATCATAAACCACGGAGCTGCGTCTGGTCACCTCGGCAGTGGA
ACTCTCCTCTTGATGCAAGCAGAGGTGCAGTTCTTGTCGCCTCTGGTGGCGGCGCGCGAG
GTGGTGTTCTTCCGTTACTGCGTGCACAACGCCGACGAGGGGAGCTGGGCGATCGTGGAT
TTCCCGGCGGAAGGGTTTGAGGAGGGGCTCCTCCAAGCCTCGGTGGTCAGGTGCCGGCGG
CGGCCGTCCGGCTGCATCATCCAGGACATGCCCAATGGATACTCCAGGGTGGTGTGGGTG
GAGCACATGGAGATGGTCGGGGAGGAGAAGCCGCTGCAGCCGGTGTTCAGGGACTACGTC
GCCAGCGGCGCCGCCTTCGGGGCCACGCGCTGGCTCTCCATCCTCCAGCGCCAGTGCGAG
CGCCTCGCCAGTGAGCTCGCCCGTAACATCGCCGACCTCGGAGTGATCCGCACCCCTGAG
GCAAGAACAAATATGATGAAGCTGTCGCAGCGGATGATCACCACTTTCTGTGCTAACATC
AGTGCTTCTGGAACCCAATCTTGGACGGCCCTCTCGGATTCAACCCAGGACACTATCAGG
GTTACAACTCGGAAGAACACTGAGCCCGGACAGCCCAGCGGTGTCATCCTCACCGCTGTC
TCCACAAGCTGGCTTCCTTTTACCCATCAGCAGGTGTTTGAGCTTCTTGCAGATGAACAA
CAGCGCTGCCAGCTTGAGATTTTGTCAAACGGCGGCTCCCTTCATGAGGTGGCACATATT
GCAAATGGATCACATCCAAGGAATTGCATCTCTCTTCTTCGCATTAACGCTGCAAGCAAC
TCGTCACAGAATGTGGAGCTCCTGCTGCAGGAGAGCAGCACCCACCCTGATGGTGGGAGC
CTGGTGGTGTTCGCGACGGTGGACGTGGACGCAATTCAGGTGACGATGAGCGGCGAGGAT
CCTTCCTACATCCCTCTCCTCCCCCTGGGCTTCGCCATCTTCCCTGCCACCAGCCCATCA
CCTGCTGCTGCACCCACCATCAGCTCAAGCACCACCACCACCACTGGCAATGGCAATGGC
GAAACCAGTAGCACTCCTCCAAGAAACAGCAGCAGCAACAACAACAATGCAGATGAGCTG
CTGCCTCCCAATGGCTGCCTCCTCACCGTCGGCATGCAGGTGCTGGCCAGCGCCGTACCT
TCTGCCAAGCTCAACCTCTCGAGTGTCACTGCGATCAACAGCCATGTCTGCAACGCCATT
CACCAGATCACAGCTGCACTCAAAAGTTCAGCAGGTGGTGCTGGGGGTGAGCCGGCGTCC
GATCAGTAG

Protein

883 aa

>Os10t0575600-01 Homeodomain-related containing protein.
MRRMFGDCQVLSSMAAMAGAASSADALFASPLIPNPALAGFMSSSAAMPFHHFSNAAATL
IPKEEGLMGGLHVAKDEGMDLEMDMELSGGSGSAHLDGLLSFADVDDDHKPQHSGHDQPP
DAAQPSGAAGGNAKKKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKF
WFQNRRTQMKAQQDRADNVILRAENENLKSDNFRLQAAIRNVVCPNCGHAAVLADMSYEE
QQLRIENARLKDELDRLACIATRYGGGGGRQPVLSTSALSCISAPPPVLMPPLDLDMNVY
SRHFAEQAPVMGCGDLIPPPVVPQHDGAAAYMGAMMAPVQEQDKQLVVDLAATAADQLAR
MCRAGEPLWVRQRGAEVMAVEEHARMFSWPVDGAKQGDGGAVARAEGTRDNAVVIMNSIN
LVDAFLDANKWMELFPSIVCKARTIQIINHGAASGHLGSGTLLLMQAEVQFLSPLVAARE
VVFFRYCVHNADEGSWAIVDFPAEGFEEGLLQASVVRCRRRPSGCIIQDMPNGYSRVVWV
EHMEMVGEEKPLQPVFRDYVASGAAFGATRWLSILQRQCERLASELARNIADLGVIRTPE
ARTNMMKLSQRMITTFCANISASGTQSWTALSDSTQDTIRVTTRKNTEPGQPSGVILTAV
STSWLPFTHQQVFELLADEQQRCQLEILSNGGSLHEVAHIANGSHPRNCISLLRINAASN
SSQNVELLLQESSTHPDGGSLVVFATVDVDAIQVTMSGEDPSYIPLLPLGFAIFPATSPS
PAAAPTISSSTTTTTGNGNGETSSTPPRNSSSNNNNADELLPPNGCLLTVGMQVLASAVP
SAKLNLSSVTAINSHVCNAIHQITAALKSSAGGAGGEPASDQ*

5'UTR

chr10:22915977..22916203 (- strand) : 227 bp

chr10:22915688..22915774 (- strand) : 87 bp

CDS

chr10:22915502..22915687 (- strand) : 186 bp

chr10:22915153..22915418 (- strand) : 266 bp

chr10:22914905..22915022 (- strand) : 118 bp

chr10:22914612..22914800 (- strand) : 189 bp

chr10:22914001..22914525 (- strand) : 525 bp

chr10:22913800..22913907 (- strand) : 108 bp

chr10:22913484..22913699 (- strand) : 216 bp

chr10:22913238..22913412 (- strand) : 175 bp

chr10:22912819..22913087 (- strand) : 269 bp

chr10:22912622..22912717 (- strand) : 96 bp

chr10:22911248..22911748 (- strand) : 501 bp

3'UTR

chr10:22910470..22911247 (- strand) : 778 bp

FASTA

>Os10t0575600-01 class=Sequence position=chr10:22910470..22916203 (- strand)
GGTTACTCCT CTTCCTCGCT CGCTCGCTCG CTGCCTTAGC CTTGACCTCC ATCGATATTG CAACCATAAA GAGGAGGAGG
AAGAGGAGGC GAGAAAGAGA GAGAGATCGT CTTCTTCTCC AGCCAGCCAG CCAGCCGTGA TTGATCTCAA GGGGGAAGGC
AGCTGCAGGG ATCAAGAAGA AGGAGAAGAA GTGATCAAGG AAGGAAGGCC ACGGAACAAC CGACAGGGTA TTTACTCCGG
CCATTTACTC CGCTTGTCTC CTTTCACCAC CACCTCTCCT CTTCCCTCCT GCTCCGCCGT AGTCCATCTC CATCCTCCAA
TCTCTTTCTC TTCTTCTTCT CTTCTCTTCT TCTCGGGAGT TAGGAGTGTG TGAGTGATTG ACTAGGGCCA TGCTCCTTCG
TCTTTGATTT TTTTTTCTAC TACTGCTAGG CAGGAGGGCG CTGGCCGGAT CGCCGGAGAA GGAACCACTA GCTAGCTAGC
TAGCTACTCC TATTGAAGAT ATCGCCGGCC GGACATATGC GCAGGATGTT CGGGGACTGC CAGGTCCTGT CGtccatggc
cgccatggcc ggggccgcct cctccgccga cgcgctcttc gcctcgccgc tcatccccAA CCCCGCTCTC GCCGGCTTCA
TGTCCTCCTC CGCCGCCATG CCCTTCCACC ACTTCTCCAA CGCCGCCGCC ACCTTAATAC CTGTAAGCTA ATCTCTTCTT
TTCTCTTTTC CTTTCTTTCT TTGCATAGCC TCATGACACT AGCTATATAC GTGCGTGCGG TGCAGAAGGA GGAGGGGTTG
ATGGGCGGCC TCCATGTGGC CAAGGACGAG GGGATGGACC TCGAGATGGA CATGGAGCTC AGTGGCGGCT CCGGCAGCGC
CCACCTCGAC GGCCTCCTCA GCTTCGCCGA CGTCGACGAC GACCACAAGC CGCAGCACAG CGGCCATGAC CAGCCGCCCG
ACGCCGCCCA GCCCAGCGGC GCCGCGGGGG GCAACGCCAA GAAGAAGCGC TACCACCGCC ACACGGCGCA CCAGATCCAG
CAGATGGAGG CGTACGGTTT TCATCTCCAT CTTCTTCTTC CTCTTCAATG CCATTGCCAG CCGTTTCGAT CGATTCGTCT
CCATTAAACC TTGCTGATAT TGTGATACTG ACAAGTGGCG TGCATGCATC CATCCATGCA GGCTGTTCAA GGAGTGCCCG
CATCCGGACG ACAAGCAGCG GCTGAAGCTG AGCCAGGAAC TGGGCCTCAA ACCTCGCCAG GTCAAGTTCT GGTTCCAGAA
TCGCCGGACC CAGATGAAGG TACTATATAT ATGCAAATTA ATAATTCCAT ATATACGCTA CTGTATTTGC AAATGCAAAT
GGCAATATGT TCATGATGCA TTGGCTGGGT TGAATATGTT CAGGCGCAGC AGGACAGGGC GGACAACGTG ATTCTGCGCG
CGGAGAACGA GAACCTCAAG AGCGACAACT TCCGCCTCCA GGCCGCCATC CGCAACGTCG TCTGCCCCAA CTGCGGCCAC
GCCGCCGTCC TCGCCGACAT GTCCTACGAG GAGCAGCAGC TCCGCATCGA GAACGCCAGG CTCAAAGACG AGGTCGCTAG
CTCCCTAAAA CCCTACCTAC CATTCATTCC CAATTCCCAA CACATAATAC TCCTCCTATA TATGCTTCCT GGCTGCAGCT
TGACCGCTTG GCCTGCATCG CCACCCGCTA CGGCGGCGGC GGCGGACGGC AGCCGGTGCT GTCGACGTCG GCCCTGAGCT
GCATCTCGGC GCCGCCGCCG GTCCTCATGC CACCGCTCGA CCTCGACATG AACGTCTACT CGCGGCACTT CGCCGAGCAG
GCGCCGGTCA TGGGCTGCGG CGACCTCATC CCGCCACCCG TCGTGCCGCA GCACGATGGC GCGGCGGCGT ACATGGGCGC
CATGATGGCG CCCGTGCAGG AGCAGGACAA GCAGCTGGTG GTCGACCTCG CCGCCACGGC GGCGGACCAG CTCGCCAGGA
TGTGCCGCGC CGGCGAGCCG CTGTGGGTGC GGCAGCGTGG CGCGGAGGTG ATGGCCGTGG AGGAGCACGC GCGGATGTTC
AGCTGGCCGG TGGACGGCGC GAAGCAGGGA GACGGCGGCG CGGTGGCGAG GGCGGAGGGG ACGCGTGACA ACGCGGTGGT
CATCATGAAC AGCATCAACT TGGTGGACGC CTTCCTCGAT GCGGTCAGTG CAGTGCAGTG ATACTGCCAT TTTCCACTAG
TATATGATGC TTCATTTCTA ATCATCTGAT TAATGTCGAT TAATATTGTT TTGCAGAACA AATGGATGGA GCTGTTCCCG
TCGATTGTTT GCAAGGCAAG AACAATCCAG ATCATAAACC ACGGAGCTGC GTCTGGTCAC CTCGGCAGTG GAACTCTCCT
CTTGGTAATT ACTAACTGAT TACTACTCCC CTACTACTGA TTGATTAGAT TAGTTGTTTT TGGGATGGAT GGGGACTGAA
ATGCGCGTGG TACATGGCAT GCAGATGCAA GCAGAGGTGC AGTTCTTGTC GCCTCTGGTG GCGGCGCGCG AGGTGGTGTT
CTTCCGTTAC TGCGTGCACA ACGCCGACGA GGGGAGCTGG GCGATCGTGG ATTTCCCGGC GGAAGGGTTT GAGGAGGGGC
TCCTCCAAGC CTCGGTGGTC AGGTGCCGGC GGCGGCCGTC CGGCTGCATC ATCCAGGACA TGCCCAATGG ATACTCCAGG
GTACGTACAT ACGCTTGCAT TGGGTGTTAA TTTGAGCATG AACATGAATG GAGGTGACAA TGGCAATGCA GGTGGTGTGG
GTGGAGCACA TGGAGATGGT CGGGGAGGAG AAGCCGCTGC AGCCGGTGTT CAGGGACTAC GTCGCCAGCG GCGCCGCCTT
CGGGGCCACG CGCTGGCTCT CCATCCTCCA GCGCCAGTGC GAGCGCCTCG CCAGTGAGCT CGCCCGTAAC ATCGCCGACC
TCGGAGGTGC GCATTACCAC TAGCTATTTG TAAATTGTGA GAATTCAGAA TCCACAGTTT GTGTAGAGTT GTGGATTCTG
AATTCTCACA ATTCACAAAA TCCATCCTGA CCATTTATGA TATAATCTTC TCGATCCCTT TGTTTCTGAT TCACAGTGAT
CCGCACCCCT GAGGCAAGAA CAAATATGAT GAAGCTGTCG CAGCGGATGA TCACCACTTT CTGTGCTAAC ATCAGTGCTT
CTGGAACCCA ATCTTGGACG GCCCTCTCGG ATTCAACCCA GGACACTATC AGGGTTACAA CTCGGAAGAA CACTGAGCCC
GGACAGCCCA GCGGTGTCAT CCTCACCGCT GTCTCCACAA GCTGGCTTCC TTTTACCCAT CAGCAGGTGT TTGAGCTTCT
TGCAGATGAA CAACAGCGCT GCCAGGTACA ATGAAGAGCC ATATAATATA CTCAGTCCAT ACTGAAAATT GTTGTTGTTC
ACCTTATAAT TCGTTGTGGT CATGTTTGTT AATTTGCCTT TTGCAGCTTG AGATTTTGTC AAACGGCGGC TCCCTTCATG
AGGTGGCACA TATTGCAAAT GGATCACATC CAAGGAATTG CATCTCTCTT CTTCGCATTA ACGTGAGTAC CCAATTACCA
CCTCTCTGAA TGATGCCATG TTTTTTCGTC CTTGTAGTAG TTAATTTCCT GATTCAAGAG CATGATCATA ATAATTGAAG
TGCTTAATGG TGCATAATAT CTAGTAGCTT TGATTAAAGA GCAAAATCAC GACGACTTAG CTAGCTCTTA AATGATTCTG
ATCAAGAATA TTATGTAGTA CTTATTGTCT AGGTTTGTCT AGTTTCTTCC ATAGTTGCAG AATTATGGAT TACTAATGGT
GAGCATGTGA ATATCTCCCC CCGTCCTGTA GAGTCCTGAA GGGACATGAA AACATGAGTC AATATGCACA CGTTGTGTGT
TTATGTCTTA TACAGTAAAA ACTAGAAAAA GATAGGGAAA TTAATTATTG TAGTATAAAT TGTAATAGCT CAATGGTAGC
AATGGTAGCT ACTGAGTTAC TGCTGTAACT GCACTCTCTG GTGAAGAACT GTTGTTCAAT TCAATAGTTT CAAGCACTCA
CTGTTTGCTA CCAATGCCAA GGACAAGAAA TTAACACCGG CTACTTGAAC TGTACATGAC TCAATATGCC ATATTAAATG
AGATTTTAGT GGTGTATGCT GGGGCTGTGT GCACATGCAT CTCTGAATTT GCTGTCATTA CATGGACAGT TTATGTCTGA
ATCTTTCTTT TTTATTTTCT GATATATATA TTAGCCCCTT TTTTTCATAT ACTACACGTA CACCTTGTAA TGCTTACAAT
CATAATGTAC CATGCACATA GATCTAGCTC ATTTCATAAT GAGAGTTGCT TACTTTACTT TTTTCCCTCT GCTGATTGAA
ACTAGATATA TAACAAGAGC TGACCTTTTT CCAATTGATA AAAACTGATG TCCAGGCTGC AAGCAACTCG TCACAGAATG
TGGAGCTCCT GCTGCAGGAG AGCAGCACCC ACCCTGATGG TGGGAGCCTG GTGGTGTTCG CGACGGTGGA CGTGGACGCA
ATTCAGGTGA CGATGAGCGG CGAGGATCCT TCCTACATCC CTCTCCTCCC CCTGGGCTTC GCCATCTTCC CTGCCACCAG
CCCATCACCT GCTGCTGCAC CCACCATCAG CTCAAGCACC ACCACCACCA CTGGCAATGG CAATGGCGAA ACCAGTAGCA
CTCCTCCAAG AAACAGCAGC AGCAACAACA ACAATGCAGA TGAGCTGCTG CCTCCCAATG GCTGCCTCCT CACCGTCGGC
ATGCAGGTGC TGGCCAGCGC CGTACCTTCT GCCAAGCTCA ACCTCTCGAG TGTCACTGCG ATCAACAGCC ATGTCTGCAA
CGCCATTCAC CAGATCACAG CTGCACTCAA AAGTTCAGCA GGTGGTGCTG GGGGTGAGCC GGCGTCCGAT CAGTAGCAAA
GGAGACCTGG AGGAGAGGGG ATCGGAGCAA CATGGGATCA GACACCAAAA TGCCTCCCAA TTTATTTCGC TAACATCGCA
GTTTGTTTTT CTGTTAGCTC TCGGTCTGGC TGGTTCATCA GGTGCAAGGG AGGGTTTGAC AAGAAGCCAA CACTAACAGC
TACTCAAATC TCTCCTCTCT TCCCGCCATA TTTCTGCCTC TCAAAATGAC GAAAATACCC CCAACCAGCC AACAAGCAAA
GCCATGGGGG GCATTTTGAT CATTTTGGGA AGCTACTTCT GCTGAGAAAG AAAGAAAGAA AGAAAGGGTC TTGTCAAGCT
CTCACTTGCA CCAACCAGCT GATTCATGAA TTTGCTGACA TCAGCTCTGC AGGCATTTTG GTCGTGCATC GGTTTCTTGC
TACTCCATCC ATCCCTCTTT AGGTTCTTCC TCCCTTTCCT CATCAAAAGT GAGAACTGCA TGTGAAGAAG GTTAGCTCCT
TGTTTTGAAT TTTTGTAATA ATAAGATGGA AGAAGAAGAC TTGGTAGCTT GAGTGTGTGG TTTGTGTTAA GATCGAGCTA
GACTTTGTGT AAGGTTGAAG AAGAAGAAGA CATTAAGCAG ATTGTTATTA GGAGATGAGA TAAGAGAAAG GAGGAGAGGA
GAAGTCAAGA GCGAACCAGT TGTGACCCTT CTTCACACTA GAAGGGGGTC TTGGTTCGGG AATTGACTTG TTACCTCTCT
GCACTCTTTG TCTGTAACCT TTGCCCTATC TTATTATTAC TACTAGTATT GTTC

Locus: Os10g0575600

Loading...

Locus: Os10g0575600

Loading...