Os10t0577600-01

Locus

Os10g0577600

Description

H3K9 demethylase, Floral organ development

RAP-DB Gene Symbol Synonym(s)

JMJ706, OsJMJ706

RAP-DB Gene Name Synonym(s)

Jumonji 706

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

JMJ706, OsJMJ706

Oryzabase Gene Name Synonym(s)

Jumonji 706

Transcript Evidence

AK073475

Protein Evidence

Q336N8

Literature

PMID: 24596329

PMID: 18765808

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 13, 2014

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor jumonji, JmjN (IPR003349)

JmjC domain (IPR003347)

Zinc finger, C5HC2-type (IPR004198)

Full-length cDNA

J033044E04 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0577600-01)

Others

Oryzabase (15203)

Transcript

3295 bp

>Os10t0577600-01 H3K9 demethylase, Floral organ development
CTCTTTCCTCCTCCGCCGCCCGCCCGCCCATTGCCGAGCTCCCCGCCGCACGCCCCAGCT
AACTACCACTCCGGCACGGCAGGGCAGGGCAGGGCTCGCCGCCGGAGGGGAATGTGGCAT
CCTTACcttccccccttgccgtaaaacaaagaaagaaagtctcccgtctcggctccttgc
gccatcgtcgacaggggaggggaggtggcgagcagtagcaggggaggggatcctccagGT
GGAGGGCAGAAACACCTATGCAACAGGTGGAGGGCAGGAACTGTCTTCCTGCGGAGGTCA
GGATTGGCCTCGAGACGCTCAAGAGGCGCCGGCTTGAGAGGATGCGTTTGACTGCTCAGA
ACAATGCCGGCGACGGTCCTCCGGTGCCCGCAAGGAGCGGTGGGGATGCGCTAAGGACTC
CCGCAAACTGCGGGGTCAGGTTGCATGCTAACAATGGCACAGCTCTACCTAGCAGAACCA
CCCAGAACAAGGACCCTTTTGCAAAGCGCAGGGTGGACAAGTTTGATATGTCTAGCCTAG
AATGGATTGACAAGATCGAAGAATGCCCTGTGTACTATCCTACCAAGGAGGAGTTCGAGG
ATCCCATTGGTTATATACAGAAGATTGCACCTGTGGCTTCGAAATACGGAATTTGCAAAA
TCGTATCTCCAGTAAGCGCTTCTGTTCCTGCTGGTGTCGTGTTGATGAAGGAACAGCCTG
GTTTCAAGTTCATGACCAGGGTTCAGCCGCTTCGCCTCGCCAAATGGGCTGAAGATGACA
CGGTCACTTTCTTCATGAGCGAAAGAAAGTACACTTTCCGGGATTATGAGAAAATGGCCA
ACAAGGTGTTCGCCAAGAAATACTCAAGTGCTAGTTGTCTCCCAGCTAAGTACGTGGAGG
AGGAATTCTGGCGCGAAATTGCTTTTGGTAAAATGGATTTTGTTGAATATGCCTGTGATG
TTGATGGTAGTGCTTTCTCCTCTTCTCCTCATGATCAACTTGGGAAAAGCAACTGGAACT
TGAAGAATTTTTCACGGCTTTCCAATTCTGTGCTTAGACTTCTGCAGACACCAATTCCAG
GAGTAACAGATCCAATGCTTTATATCGGGATGCTCTTCAGCATGTTTGCTTGGCATGTGG
AAGATCATTATTTGTACAGCATCAATTACCATCATTGTGGGGCATTTAAGACATGGTATG
GCATACCGGGTGATGCTGCTCCTGGGTTTGAAAAGGTGGCTAGCCAGTTTGTATACAACA
AGGATATTTTGGTTGGTGAAGGAGAGGATGCAGCATTTGATGTTCTCTTGGGGAAGACAA
CAATGTTCCCCCCAAATGTCTTGTTAGACCACAACGTTCCTGTTTATAAAGCTGTGCAAA
AACCTGGGGAGTTTGTCATTACTTTCCCTCGTTCCTACCACGCGGGTTTCAGCCACGGCT
TCAATTGTGGCGAGGCTGTCAACTTTGCTATCAGTGACTGGTTTCCTCTGGGTTCTGTGG
CCAGCAGACGCTACGCGCTTCTGAACAGAACACCCTTGCTTGCACACGAGGAGTTACTTT
GCCGTTCTGCAGTGCTTCTGTCCCACAAACTGTTAAACAGCGACCCAAAATCCCTCAATA
AATCTGAGCATCCACATTCACAGCGTTGTTTGAAGTCTTGCTTTGTGCAGTTGATGCGAT
TCCAGAGAAACACACGTGGCCTACTTGCTAAAATGGGCTCTCAGATACATTATAAGCCAA
AAACATACCCGAATCTCTCATGTAGCATGTGTCGGCGTGATTGCTACATTACACATGTGT
TGTGTGGATGCAACTTTGACCCAGTCTGTCTTCATCACGAACAAGAACTCCGGAGCTGCC
CTTGTAAATCTAACCAGGTTGTCTACGTTAGGGAGGACATACAGGAGCTAGAAGCTCTAT
CAAGAAAATTTGAGAAGGATATTTGCTTGGATAAGGAAATAAGTGGTTTTGACTCATACA
AGCAGGCCGAAAAGAATGAGCCATTTTTTGAGATAACTCGGAACCTCAGGAACACTGAAG
TAAATTTGATAGAGGATGCCTTCTCAGGAGCAACTGCTGCTGATGCTGCAAAGAGTTCTC
CTGCAACGTCAACACTGACATCTTTTGCACAACATGATGTGCCTGTTCTTGCTGAAGCAA
TTGTCTGTGCTAATCAAGCCGACCAATTATACTCCACCACCGAGCAAACCATCAGCTCAC
CTTTAGTCAAAGGAACTGATGCTGTGGGTGCAAATTCATCCAGCATGGCTGATGCTAATA
ACGGAACTGGTTCTTGTAATGCTTCAGCTGTGGAATACAGTGGAAATTCAGATTCTGAAT
CTGAAATATTTCGAGTCAAGCGCAGGTCTGGCGTATCAGTAAAGCCTGCATCTGATGCCA
AGACATCAAACTTGTCTGATCAACAGGTTCTCAGGCGGTTGAAGAAGGTGCGCCCTGAAA
TACAACAGCACAATAAGCGACCAGAAGACTATGGTCACTGTTCAGTTCCCTCAGGTCGTA
TGAGTATGAAGAATTTGAATTCATCCTCCTCATGTGGTGAAGAACACTGGAGGATGAAGC
GGCGGCAGTTGGAGACTCAGCAGGATGAGAGCAGTTATTCTGCAAAGCAGAAGTCGTACT
CGTATCCATCCACCAGCTATTCTTTCCGAGGAGAGTTTGTGGAAATGAGTAGAGATGCTG
CTGCAGAAGTCCGACCAAAGCGACTGAAAATCCGGCTACCTTCTTCTAGCACGAACAGAG
TGGTTGAGCAGGGCAGTTCAGGGCAAAGATTTACAAGGGATGACAAGTCGCTTGGTTGTT
GGCCTGCAATTTAGAATTTAGAAAAAAATGCTGACGCAGGTGCTAACCTCTGATGGAGAT
AAAGATTTCCTTGTTTAGGTGGGGCTGTTGACTACACGAAATGATAGGGCTGGGATGGAT
CGATGAGGTTGAATATAAATGATTAGCACAGAAGCTGACTGACTTTAGAAGGCTGGTTAA
TCGATTCTTTGTGCAGCAGTGCCTCCAATTTGAGGCACATCTAGGCACGGTTAGAAGAGA
CAGACACATGACGATTCTTGTTGCTGGAGGTTCTGGGTCACTGCTTTGCTGCTGTTTGAT
GCCTGCACTGCAAGTGACGTACACACACTATAGGACCTCGCTCTACCCTTTGATTATATC
TCTCTATTTTTCTTCTTCTTTGTCAGCAACCTTAGCTGCTGCTACTCTATAGCTAACTGT
ATTCTTTCATACGCTTGTTCCATCAAGTTAATCTGCTGCTTAATGCCATTGATTC

CDS

2577 bp

>Os10t0577600-01 H3K9 demethylase, Floral organ development
ATGCAACAGGTGGAGGGCAGGAACTGTCTTCCTGCGGAGGTCAGGATTGGCCTCGAGACG
CTCAAGAGGCGCCGGCTTGAGAGGATGCGTTTGACTGCTCAGAACAATGCCGGCGACGGT
CCTCCGGTGCCCGCAAGGAGCGGTGGGGATGCGCTAAGGACTCCCGCAAACTGCGGGGTC
AGGTTGCATGCTAACAATGGCACAGCTCTACCTAGCAGAACCACCCAGAACAAGGACCCT
TTTGCAAAGCGCAGGGTGGACAAGTTTGATATGTCTAGCCTAGAATGGATTGACAAGATC
GAAGAATGCCCTGTGTACTATCCTACCAAGGAGGAGTTCGAGGATCCCATTGGTTATATA
CAGAAGATTGCACCTGTGGCTTCGAAATACGGAATTTGCAAAATCGTATCTCCAGTAAGC
GCTTCTGTTCCTGCTGGTGTCGTGTTGATGAAGGAACAGCCTGGTTTCAAGTTCATGACC
AGGGTTCAGCCGCTTCGCCTCGCCAAATGGGCTGAAGATGACACGGTCACTTTCTTCATG
AGCGAAAGAAAGTACACTTTCCGGGATTATGAGAAAATGGCCAACAAGGTGTTCGCCAAG
AAATACTCAAGTGCTAGTTGTCTCCCAGCTAAGTACGTGGAGGAGGAATTCTGGCGCGAA
ATTGCTTTTGGTAAAATGGATTTTGTTGAATATGCCTGTGATGTTGATGGTAGTGCTTTC
TCCTCTTCTCCTCATGATCAACTTGGGAAAAGCAACTGGAACTTGAAGAATTTTTCACGG
CTTTCCAATTCTGTGCTTAGACTTCTGCAGACACCAATTCCAGGAGTAACAGATCCAATG
CTTTATATCGGGATGCTCTTCAGCATGTTTGCTTGGCATGTGGAAGATCATTATTTGTAC
AGCATCAATTACCATCATTGTGGGGCATTTAAGACATGGTATGGCATACCGGGTGATGCT
GCTCCTGGGTTTGAAAAGGTGGCTAGCCAGTTTGTATACAACAAGGATATTTTGGTTGGT
GAAGGAGAGGATGCAGCATTTGATGTTCTCTTGGGGAAGACAACAATGTTCCCCCCAAAT
GTCTTGTTAGACCACAACGTTCCTGTTTATAAAGCTGTGCAAAAACCTGGGGAGTTTGTC
ATTACTTTCCCTCGTTCCTACCACGCGGGTTTCAGCCACGGCTTCAATTGTGGCGAGGCT
GTCAACTTTGCTATCAGTGACTGGTTTCCTCTGGGTTCTGTGGCCAGCAGACGCTACGCG
CTTCTGAACAGAACACCCTTGCTTGCACACGAGGAGTTACTTTGCCGTTCTGCAGTGCTT
CTGTCCCACAAACTGTTAAACAGCGACCCAAAATCCCTCAATAAATCTGAGCATCCACAT
TCACAGCGTTGTTTGAAGTCTTGCTTTGTGCAGTTGATGCGATTCCAGAGAAACACACGT
GGCCTACTTGCTAAAATGGGCTCTCAGATACATTATAAGCCAAAAACATACCCGAATCTC
TCATGTAGCATGTGTCGGCGTGATTGCTACATTACACATGTGTTGTGTGGATGCAACTTT
GACCCAGTCTGTCTTCATCACGAACAAGAACTCCGGAGCTGCCCTTGTAAATCTAACCAG
GTTGTCTACGTTAGGGAGGACATACAGGAGCTAGAAGCTCTATCAAGAAAATTTGAGAAG
GATATTTGCTTGGATAAGGAAATAAGTGGTTTTGACTCATACAAGCAGGCCGAAAAGAAT
GAGCCATTTTTTGAGATAACTCGGAACCTCAGGAACACTGAAGTAAATTTGATAGAGGAT
GCCTTCTCAGGAGCAACTGCTGCTGATGCTGCAAAGAGTTCTCCTGCAACGTCAACACTG
ACATCTTTTGCACAACATGATGTGCCTGTTCTTGCTGAAGCAATTGTCTGTGCTAATCAA
GCCGACCAATTATACTCCACCACCGAGCAAACCATCAGCTCACCTTTAGTCAAAGGAACT
GATGCTGTGGGTGCAAATTCATCCAGCATGGCTGATGCTAATAACGGAACTGGTTCTTGT
AATGCTTCAGCTGTGGAATACAGTGGAAATTCAGATTCTGAATCTGAAATATTTCGAGTC
AAGCGCAGGTCTGGCGTATCAGTAAAGCCTGCATCTGATGCCAAGACATCAAACTTGTCT
GATCAACAGGTTCTCAGGCGGTTGAAGAAGGTGCGCCCTGAAATACAACAGCACAATAAG
CGACCAGAAGACTATGGTCACTGTTCAGTTCCCTCAGGTCGTATGAGTATGAAGAATTTG
AATTCATCCTCCTCATGTGGTGAAGAACACTGGAGGATGAAGCGGCGGCAGTTGGAGACT
CAGCAGGATGAGAGCAGTTATTCTGCAAAGCAGAAGTCGTACTCGTATCCATCCACCAGC
TATTCTTTCCGAGGAGAGTTTGTGGAAATGAGTAGAGATGCTGCTGCAGAAGTCCGACCA
AAGCGACTGAAAATCCGGCTACCTTCTTCTAGCACGAACAGAGTGGTTGAGCAGGGCAGT
TCAGGGCAAAGATTTACAAGGGATGACAAGTCGCTTGGTTGTTGGCCTGCAATTTAG

Protein

859 aa

>Os10t0577600-01 H3K9 demethylase, Floral organ development
MQQVEGRNCLPAEVRIGLETLKRRRLERMRLTAQNNAGDGPPVPARSGGDALRTPANCGV
RLHANNGTALPSRTTQNKDPFAKRRVDKFDMSSLEWIDKIEECPVYYPTKEEFEDPIGYI
QKIAPVASKYGICKIVSPVSASVPAGVVLMKEQPGFKFMTRVQPLRLAKWAEDDTVTFFM
SERKYTFRDYEKMANKVFAKKYSSASCLPAKYVEEEFWREIAFGKMDFVEYACDVDGSAF
SSSPHDQLGKSNWNLKNFSRLSNSVLRLLQTPIPGVTDPMLYIGMLFSMFAWHVEDHYLY
SINYHHCGAFKTWYGIPGDAAPGFEKVASQFVYNKDILVGEGEDAAFDVLLGKTTMFPPN
VLLDHNVPVYKAVQKPGEFVITFPRSYHAGFSHGFNCGEAVNFAISDWFPLGSVASRRYA
LLNRTPLLAHEELLCRSAVLLSHKLLNSDPKSLNKSEHPHSQRCLKSCFVQLMRFQRNTR
GLLAKMGSQIHYKPKTYPNLSCSMCRRDCYITHVLCGCNFDPVCLHHEQELRSCPCKSNQ
VVYVREDIQELEALSRKFEKDICLDKEISGFDSYKQAEKNEPFFEITRNLRNTEVNLIED
AFSGATAADAAKSSPATSTLTSFAQHDVPVLAEAIVCANQADQLYSTTEQTISSPLVKGT
DAVGANSSSMADANNGTGSCNASAVEYSGNSDSESEIFRVKRRSGVSVKPASDAKTSNLS
DQQVLRRLKKVRPEIQQHNKRPEDYGHCSVPSGRMSMKNLNSSSSCGEEHWRMKRRQLET
QQDESSYSAKQKSYSYPSTSYSFRGEFVEMSRDAAAEVRPKRLKIRLPSSSTNRVVEQGS
SGQRFTRDDKSLGCWPAI*

5'UTR

chr10:23025815..23026052 (+ strand) : 238 bp

chr10:23027332..23027350 (+ strand) : 19 bp

CDS

chr10:23027351..23027741 (+ strand) : 391 bp

chr10:23027864..23028020 (+ strand) : 157 bp

chr10:23028098..23028317 (+ strand) : 220 bp

chr10:23028433..23028486 (+ strand) : 54 bp

chr10:23028573..23028652 (+ strand) : 80 bp

chr10:23028739..23029016 (+ strand) : 278 bp

chr10:23029098..23029499 (+ strand) : 402 bp

chr10:23029573..23029895 (+ strand) : 323 bp

chr10:23029970..23030233 (+ strand) : 264 bp

chr10:23030833..23031240 (+ strand) : 408 bp

3'UTR

chr10:23031241..23031701 (+ strand) : 461 bp

FASTA

>Os10t0577600-01 class=Sequence position=chr10:23025815..23031701 (+ strand)
CTCTTTCCTC CTCCGCCGCC CGCCCGCCCA TTGCCGAGCT CCCCGCCGCA CGCCCCAGCT AACTACCACT CCGGCACGGC
AGGGCAGGGC AGGGCTCGCC GCCGGAGGGG AATGTGGCAT CCTTACcttc cccccttgcc gtaaaacaaa gaaagaaagt
ctcccgtctc ggctccttgc gccatcgtcg acaggggagg ggaggtggcg agcagtagca ggggagggga tcctccaggt
gaccatcctc tttctcacaa attcttctct ctcccaccgg gactacaatt tgcttgcgtt ccttaatttc gcaccctctt
ttagatctgg tgcaagaagc tcttctcctc cttaatttcg caccctcctt taccgcaata ctacaatcta gtttgttgtc
tgttcccccC CATCCAATTT ACCCTAGATT CCTCATCAAA TCACACCATT TTCCCTCACC CTCCTCAGCC CCACGGATTA
CCGCCTTCTT TTTCTTACTA CTAATTGCCG TCCGTCCGTT GATGTTTGGA AAAAGTACCA CTTTTCTTCT TCCTTAATCT
TAATTTGACG ACGACGCGTA GAGGAGAGGA GGTACAGAAC CACCGGTATC TAATCAAACA GAGACAAGAA AGTTGGAATC
CTAATTTGGC CCCGGGTCGC TGCAACAGAA TGCAAGACTA GATTGACACC TAGATTTACC TTACCTTAGA CCGGGCCACA
AGTCAACGCG CTCAATTCAT TTCATTTACC ACCACACCAC TAGTCGTTCC TCCATCCTGG AGTACTACTG TAGTAGGAGT
AGTTTTTAGT ATTCATTACT CTCTGTATGG ATGGGATATT ACTACTACTG TAGTAGAGTA GTCAAGAGGC GGTCTTCCAT
TCTTGCCGTG TGGGGTTCAG GGGGCATCTC CTCTCCTCTC ATCTTTCTTT TTTGACGATT TCTTCGTCTC TCTAAAATGG
CCTGGTCATA TCGCATGTGC GTAATTCCCC CCCTCTGACC ACGTCCAGTC CACTGCAAAA ATTTTAACCT TTTCTTCTCT
TTTTCTCTTC CAAGGCCCTA CATTTTTGTA CTACTCCACA TTTATATGCC CTTCTTCTCC TCATCCTCAA TCTGAATCCG
CCGTTATTTT CTCTCTCTAA CTCATGTAAT GGTTTCTGTT CGTGTGAGCA CCCACCATTG CCACGAATCG TTAGAGATGC
AGCACTGCTA CCATTTTTTA TACAACTAAA ATACTAATAC AATTAATTAA TGGCTGGTTG ATTGTGACTT CTGGCTGTGG
TAGGGGAAAA CCACCCCAAT GTGCCGTGTC TGAATCCAAT ACTGTAGCTT TCTTTGACTT GGTTGGGACT TGCCCTTCTT
TCGGTGCTAC CTGGCTGTGA CCAATTCATA CAAACCGTTG GTGCTTGTTC ACTCTGCTGT CTCTGTTGGT CAATGCCACT
GGCCTTCCCA GATTTTGCAC ATGAACCTTC TTCGTTGCTC CTTCATTCCG TAATGTGTCC GTTTACCTAT GCAACAGGTG
GAGGGCAGAA ACACCTATGC AACAGGTGGA GGGCAGGAAC TGTCTTCCTG CGGAGGTCAG GATTGGCCTC GAGACGCTCA
AGAGGCGCCG GCTTGAGAGG ATGCGTTTGA CTGCTCAGAA CAATGCCGGC GACGGTCCTC CGGTGCCCGC AAGGAGCGGT
GGGGATGCGC TAAGGACTCC CGCAAACTGC GGGGTCAGGT TGCATGCTAA CAATGGCACA GCTCTACCTA GCAGAACCAC
CCAGAACAAG GACCCTTTTG CAAAGCGCAG GGTGGACAAG TTTGATATGT CTAGCCTAGA ATGGATTGAC AAGATCGAAG
AATGCCCTGT GTACTATCCT ACCAAGGAGG AGTTCGAGGA TCCCATTGGT TATATACAGA AGATTGCACC TGTGGCTTCG
AAATACGGTA CTGCTTCCGT TTCTCGTTGC CCTCATCGTC TGTTGACAGT GTATTACTGA TTGATCTGCC AGTCTACGCA
GAATCTTACT TTCTAAATGA ATGATCATGG GCTATTATTT TCTCCCCAGG AATTTGCAAA ATCGTATCTC CAGTAAGCGC
TTCTGTTCCT GCTGGTGTCG TGTTGATGAA GGAACAGCCT GGTTTCAAGT TCATGACCAG GGTTCAGCCG CTTCGCCTCG
CCAAATGGGC TGAAGATGAC ACGGTCACTT TCTTCATGAG CGAAAGGTGT GGTATTTCTT GGTTCATTTT CATTATTGGC
TGCTTATCTC CCAGGTCTCA TGATGCTTGG CATGATTTTG CAGAAAGTAC ACTTTCCGGG ATTATGAGAA AATGGCCAAC
AAGGTGTTCG CCAAGAAATA CTCAAGTGCT AGTTGTCTCC CAGCTAAGTA CGTGGAGGAG GAATTCTGGC GCGAAATTGC
TTTTGGTAAA ATGGATTTTG TTGAATATGC CTGTGATGTT GATGGTAGTG CTTTCTCCTC TTCTCCTCAT GATCAACTTG
GGAAAAGCAA CTGGAACTTG AAGGTGACTA ACTCTCTTCT GTGTTTGTGT GTGTGGATGT GTCGTCACAT GAGTGCATGT
TTAAATATTT GCTCACTGGT AGTATGTGTT TTACTGATCG TATTTTTTTG TTTCGTAGAA TTTTTCACGG CTTTCCAATT
CTGTGCTTAG ACTTCTGCAG ACACCAATTC CAGTAAGTCA TTTATTTACT ACTTAATGTG TTTCACATTC TTTAACATGG
CCAAAATTTC ATGATTGTAT TACACTCATC CAAAACAGGG AGTAACAGAT CCAATGCTTT ATATCGGGAT GCTCTTCAGC
ATGTTTGCTT GGCATGTGGA AGATCATTAT TTGTACAGGT ATAAATTCTC GGTTCTCCAT GGTTACTCTT TCTTTTTTGC
TCGTAATTAA TACTGGTGTT CTGACATTTT ATTCATATGA CCAGCATCAA TTACCATCAT TGTGGGGCAT TTAAGACATG
GTATGGCATA CCGGGTGATG CTGCTCCTGG GTTTGAAAAG GTGGCTAGCC AGTTTGTATA CAACAAGGAT ATTTTGGTTG
GTGAAGGAGA GGATGCAGCA TTTGATGTTC TCTTGGGGAA GACAACAATG TTCCCCCCAA ATGTCTTGTT AGACCACAAC
GTTCCTGTTT ATAAAGCTGT GCAAAAACCT GGGGAGTTTG TCATTACTTT CCCTCGTTCC TACCACGCGG GTTTCAGCCA
CGGTATGTAT CTTTCAGTTT GTGCATGTGT TATAACGCCA CTATCATATG CATAGTATTC TAAGGAATGT TTCAACTACC
CAGGCTTCAA TTGTGGCGAG GCTGTCAACT TTGCTATCAG TGACTGGTTT CCTCTGGGTT CTGTGGCCAG CAGACGCTAC
GCGCTTCTGA ACAGAACACC CTTGCTTGCA CACGAGGAGT TACTTTGCCG TTCTGCAGTG CTTCTGTCCC ACAAACTGTT
AAACAGCGAC CCAAAATCCC TCAATAAATC TGAGCATCCA CATTCACAGC GTTGTTTGAA GTCTTGCTTT GTGCAGTTGA
TGCGATTCCA GAGAAACACA CGTGGCCTAC TTGCTAAAAT GGGCTCTCAG ATACATTATA AGCCAAAAAC ATACCCGAAT
CTCTCATGTA GCATGTGTCG GCGTGATTGC TACATTACAC ATGTGTTGTG TGGATGCAAC TTTGACCCAG TCTGTCTTCA
TCACGGTAGG AAATGTTAGC ATTGCTCTTT TGCACTTTCT TTTGTATTTT ACCTAATACT TTGGTTATTG GACTGCAGAA
CAAGAACTCC GGAGCTGCCC TTGTAAATCT AACCAGGTTG TCTACGTTAG GGAGGACATA CAGGAGCTAG AAGCTCTATC
AAGAAAATTT GAGAAGGATA TTTGCTTGGA TAAGGAAATA AGTGGTTTTG ACTCATACAA GCAGGCCGAA AAGAATGAGC
CATTTTTTGA GATAACTCGG AACCTCAGGA ACACTGAAGT AAATTTGATA GAGGATGCCT TCTCAGGAGC AACTGCTGCT
GATGCTGCAA AGAGTTCTCC TGCAACGTCA ACACTGACAT CTTTTGCACA ACATGATGTG CCTGTTCTTG CTGAAGCAAT
TGTAGGTTTA CCATCATGCA TATATTTCCA GCTGTTATCT TTCTGTTGGG TTAATGTTCT TGTTATTTTA TTTAGGTCTG
TGCTAATCAA GCCGACCAAT TATACTCCAC CACCGAGCAA ACCATCAGCT CACCTTTAGT CAAAGGAACT GATGCTGTGG
GTGCAAATTC ATCCAGCATG GCTGATGCTA ATAACGGAAC TGGTTCTTGT AATGCTTCAG CTGTGGAATA CAGTGGAAAT
TCAGATTCTG AATCTGAAAT ATTTCGAGTC AAGCGCAGGT CTGGCGTATC AGTAAAGCCT GCATCTGATG CCAAGACATC
AAACTTGTCT GATCAACAGG TACGTTAAAT TTTCATCTTT TACACCCCTT TGGCTTATCA TCAACTTTTA GGtactccct
ccggttctaa attaattgac gttttggaca aggttgagat caatttttta taactttgac catcaataac tttaaaaata
tttagtttaa agaaactaaa acaacatata tagatttgtc ttttaaagca ctataataaa agtaaacatg tatttattta
ttatatatat tatagtagaa aaataaggtc aaagatatat cttgtagacc gtgtcattgt ccaaaatgtc aattaaaatg
gaaccggagg gagtaATTGC ACTGTTTAAG GGAAAATACT TCATGTAAGA ATAAATGACA TGCTATATAA ATGGCCAGGC
ATCTCCAGTT GTCGAGGTCA TTTGATAGAT AATAATGGGC AATCATGTCA TAAATAAATA AGTTGCAGCT CTAGTTATGT
ATTAATTAAG TTCCTGTACC ATTTTACACC AAGGTCCAAG GGTCTTTATA TGAAGGATGA CATACGGGCC CATAGCATTT
AGTTGTCCTA TTTTAGATAG TGCTTACTTT TGGTTCTGAT GTAAAATACT GGAATCAGGT TCTCAGGCGG TTGAAGAAGG
TGCGCCCTGA AATACAACAG CACAATAAGC GACCAGAAGA CTATGGTCAC TGTTCAGTTC CCTCAGGTCG TATGAGTATG
AAGAATTTGA ATTCATCCTC CTCATGTGGT GAAGAACACT GGAGGATGAA GCGGCGGCAG TTGGAGACTC AGCAGGATGA
GAGCAGTTAT TCTGCAAAGC AGAAGTCGTA CTCGTATCCA TCCACCAGCT ATTCTTTCCG AGGAGAGTTT GTGGAAATGA
GTAGAGATGC TGCTGCAGAA GTCCGACCAA AGCGACTGAA AATCCGGCTA CCTTCTTCTA GCACGAACAG AGTGGTTGAG
CAGGGCAGTT CAGGGCAAAG ATTTACAAGG GATGACAAGT CGCTTGGTTG TTGGCCTGCA ATTTAGAATT TAGAAAAAAA
TGCTGACGCA GGTGCTAACC TCTGATGGAG ATAAAGATTT CCTTGTTTAG GTGGGGCTGT TGACTACACG AAATGATAGG
GCTGGGATGG ATCGATGAGG TTGAATATAA ATGATTAGCA CAGAAGCTGA CTGACTTTAG AAGGCTGGTT AATCGATTCT
TTGTGCAGCA GTGCCTCCAA TTTGAGGCAC ATCTAGGCAC GGTTAGAAGA GACAGACACA TGACGATTCT TGTTGCTGGA
GGTTCTGGGT CACTGCTTTG CTGCTGTTTG ATGCCTGCAC TGCAAGTGAC GTACACACAC TATAGGACCT CGCTCTACCC
TTTGATTATA TCTCTCTATT TTTCTTCTTC TTTGTCAGCA ACCTTAGCTG CTGCTACTCT ATAGCTAACT GTATTCTTTC
ATACGCTTGT TCCATCAAGT TAATCTGCTG CTTAATGCCA TTGATTC

Locus: Os10g0577600

Loading...

Locus: Os10g0577600

Loading...