Os11t0101400-00

Locus

Os11g0101400

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCCT37

Oryzabase Gene Name Synonym(s)

CCT domain-containing gene 37, CCT (CO, CO-LIKE and TOC1) domain protein 37, CCT domain protein 37

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os11t0101400-00)

Others

Oryzabase (19177)

Transcript

390 bp

>Os11t0101400-00
ATGCCTAAGAGGAGGAGGCCTGGCACGAAATGTGAAGCATATCAGAAGTACGCTTGCCGG
AAGAGGCTTGCGGACGAGAGGGCGAGGGTGAAGGGCCGCTTCGTCTCCAGCTCCGGCGGC
AACGATAATAATGCACCTGCACATGAGCTGCCGCCGTCGCTTGTCAATCTCAGCGATGGT
GGTGCTGCTGCTGCAATCATCCCAACAAGAAGTGTGCCGGAGTGGTGGCCAGAAATGCAG
GCGTCATTGGCCAGGGATGAGATGTGTGGCGGCGCGGGCATGAATCTCCACCTGTGCGAC
GCCAACGAGATGGAGCAGGTTGCTGCCTACGTTGGCGTCTCCTCCATGGACCTCTGCGCC
TACCTGCACTGCTCATGGCCGCCCGTCTAG

CDS

390 bp

>Os11t0101400-00
ATGCCTAAGAGGAGGAGGCCTGGCACGAAATGTGAAGCATATCAGAAGTACGCTTGCCGG
AAGAGGCTTGCGGACGAGAGGGCGAGGGTGAAGGGCCGCTTCGTCTCCAGCTCCGGCGGC
AACGATAATAATGCACCTGCACATGAGCTGCCGCCGTCGCTTGTCAATCTCAGCGATGGT
GGTGCTGCTGCTGCAATCATCCCAACAAGAAGTGTGCCGGAGTGGTGGCCAGAAATGCAG
GCGTCATTGGCCAGGGATGAGATGTGTGGCGGCGCGGGCATGAATCTCCACCTGTGCGAC
GCCAACGAGATGGAGCAGGTTGCTGCCTACGTTGGCGTCTCCTCCATGGACCTCTGCGCC
TACCTGCACTGCTCATGGCCGCCCGTCTAG

Protein

130 aa

>Os11t0101400-00
MPKRRRPGTKCEAYQKYACRKRLADERARVKGRFVSSSGGNDNNAPAHELPPSLVNLSDG
GAAAAIIPTRSVPEWWPEMQASLARDEMCGGAGMNLHLCDANEMEQVAAYVGVSSMDLCA
YLHCSWPPV*

CDS

chr11:52730..52777 (+ strand) : 48 bp

chr11:52925..53266 (+ strand) : 342 bp

FASTA

>Os11t0101400-00 class=Sequence position=chr11:52730..53266 (+ strand)
ATGCCTAAGA GGAGGAGGCC TGGCACGAAA TGTGAAGCAT ATCAGAAGGT TAGAAATGTG CAAGATTTTG GTCCCAATTT
TTATTATAAC ATGATTTAGG AATTCCGTAA TTAGTACTGC ATTAAGTATT CTTAATTGTA ACATTGCAAA GCTGATCATG
TGTACGTGCA TTAATATTTG GTATTCATTG ATCAGTACGC TTGCCGGAAG AGGCTTGCGG ACGAGAGGGC GAGGGTGAAG
GGCCGCTTCG TCTCCAGCTC CGGCGGCAAC GATAATAATG CACCTGCACA TGAGCTGCCG CCGTCGCTTG TCAATCTCAG
CGATGGTGGT GCTGCTGCTG CAATCATCCC AACAAGAAGT GTGCCGGAGT GGTGGCCAGA AATGCAGGCG TCATTGGCCA
GGGATGAGAT GTGTGGCGGC GCGGGCATGA ATCTCCACCT GTGCGACGCC AACGAGATGG AGCAGGTTGC TGCCTACGTT
GGCGTCTCCT CCATGGACCT CTGCGCCTAC CTGCACTGCT CATGGCCGCC CGTCTAG

Locus: Os11g0101400

Loading...

Locus: Os11g0101400

Loading...