Os11t0104300-01

Locus

Os11g0104300

Description

Substrate of the SCFD3 ubiquitination complex, Repressor of strigolactone (SL) signalling

RAP-DB Gene Symbol Synonym(s)

D53, D53(D K3), DK3, Dwf34

RAP-DB Gene Name Synonym(s)

DWARF KYUSHU 3, Dwarf Kyushu3, Dwarf Kyushu 3, Dwarf Kyushu-3, dwarf-53, DWARF 53, DWARF53

CGSNL Gene Symbol

D53

CGSNL Gene Name

DWARF KYUSHU 3

Oryzabase Gene Symbol Synonym(s)

D53(D K3), DK3, Dwf34, SMXL6/7/8, OsD53

Oryzabase Gene Name Synonym(s)

Dwarf Kyushu3, Dwarf Kyushu 3, Dwarf Kyushu-3, dwarf-53, DWARF 53, DWARF53, SUPPRESSOR OF MAX2-LIKE6/7/8

Transcript Evidence

KF709434

Protein Evidence

Q2RBP2

Literature

PMID: 24336215

PMID: 24336200

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

January 25, 2017

Gene Ontology (GO)

Biological Process: protein metabolic process (GO:0019538)

Functional domain (InterPro)

Clp, N-terminal (IPR004176)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Expression Databases

TENOR (Os11t0104300-01)

Others

Oryzabase (921)

KEGG (Os11t0104300-01)

Transcript

3396 bp

>Os11t0104300-01 Substrate of the SCFD3 ubiquitination complex, Repressor of strigolactone (SL) signalling
ATGCCCACTccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctc
gacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctc
atctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcc
cgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtc
tccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgag
ccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgc
aacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtc
aaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtc
ttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccg
cccatgccgctcctcggccgcctccccaCGCGCACCCGTCCGCCGCCTCTCTTCCTCTGC
AGCTTCGCCGCCGCGGACGACGCCGACGTCCCTTCGCCGGCCGGGAATCTCGCCGGCGCG
GGGGAGGAGAACTGCCGCCGCATCGCGGAGATCCTCTCCCGCGGCCGCAACCCCATGCTC
GTCGGCGTCGGGGCCGCCTCCGCCGCCGACGACTTCGCGGCCGCCTCCCCGTATCGTATC
ATCCATGTCGACCCCAACACCATCGACCGCTCAGACCTCGGCGTGGCGGCGGCAATGGCC
AGTGCCACCTCCGGCCTCATCATAAGCATCGGAGACCTCAAGCAGCTGGTCCCCGATGAG
GACGCGGAGGCGCAGGAGAAGGGGCGGCGGGTGGTGGCGGAGGTGACGCGAGTGCTGGAG
ACGCACAGCAAGGTCGGCCGCGTCTGGGTGATGGGGTGGTCGGCAACGTACGAGACCTAC
CTCGCCTTCCTCTCCAAATTCCCCTTGGTCGACAAGGATTGGGACCTCCAGCTGCTGCCA
ATCACCGCGGTGCATGCCGCCGCCACCGCTGGCCCTGCTGCTGCTGCTGCTGGACTCATG
CCTCCGGCAACCACTGTTGCTGCCTTCTCCAAGCCAGCTGCAAGCTTGATGGACTCCTTT
GTTCCTTTTGGAGGCTTTCTCTGTGATAACTACGAAGAGAACAGCCTGACAGCAAATTCA
TGCCCACAGGCCCTGCGGTGCCAGCAGTGCAATGATAAATATGAGCAAGAAGTTGCAACT
ATCATTAGCGCAAGTGGCATTACAGCTGAAGACCATCACCAGGGAGGTCTTCCTTCCCTG
CTGCAGAATGGCAGCATGATGGGTCCTAACAATGGATTTGATCCAGTCAAGGCTAGAGAT
GATCGGATGGTATTGAATTCAAAAATATTGAATCTACGGAAGAAGTGGAATGAGTACTGC
CTGCGGCTCCACCAAGACCACCAGAGGATCAACAGAGATCCTTACAAACCATTTCCGCGC
TATATTGGTGTTCCCACTGACAAAGAAAGATCAGCAAATTCAAGCAAAGGTTCTGAGTCA
GTTGGGGTTCAAAAGGATGTTATTAAACCTTGTGCGGTGTCTGCTGTACATTCCAGCTCA
ACTGCAAGGCCTATTTCATCTCCATCTGTCACCAACAAAAGAAATGAAGATCTTGTATTG
AACCTTCAAGCCAGGCATTCCAAGAGTGATGAAAACCTTCAAGAAAGGGGCATGCAATCC
CAACATGGCACCCTGTCGAATGTTGACAATCCGGATGATCATGTCTCACCATCATCTGCT
GCACCTGTGGAAACTGACTTGGTTTTGGGCACCCCTCGAGAGTGTAGTTCGAAAGGTTCA
AGTTCCACCTGCAGTAAACGTGTAGAGGATTCAGAGAGGTCTGTCCATCTGGTACCCAAG
AAGGTGGATGATTTAAATCTGAAGCATCCACAACTCTCTGTTCAACCTAATTCCTGCTCC
TGGAGTTCCATAAATGTTGGGAAAACATCACACAGTACACTACACTCAGTAGCTTCAGGA
GGCTTCTCTGCCTTTGGCCAATGGCAGAAACGGTCACCTCTTGCTGCACAAAATTCTGAT
CTGAGCAATTACAAGCTACTTGTTGAACGCCTGTTCAAGGTAGTTGGAAGGCAGGAGGAA
GCCTTGAGTGCTATTTGTGAATCCATTGTGCGGTGCCGGTCAACAGAGTCGCGCCGTGGT
CCTAACAGGAATGACATCTGGTTGTGTTTTCATGGTTCTGACAGCATGGCCAAGAAGAGA
ATCGCCGTGGCACTTGCAGAGCTCATGCACGGCAGCAAAGATAACTTGATTTATCTGGAC
CTAAACCTTCAGGATTGGGATGACTCCAGTTTCAGAGGGAAGACTGGCATAGACTGCATT
GTGGAGCAGTTGAGCAAGAAACGGCAATCTGTTCTCTTCCTTGACAACATTGATAGAGCT
GACTGCCTTGTTCAGGATAGTCTATCTGATGCTATTAAGTCTGGCAGGTTCCAAGACATG
CGAGGCAAGGTGGTTGACATTAATGACTCGATTGTGGTTTTGTCAAGAAGCATGATACAG
GGCAGCAAAAATGGGTTGGAAGAGGGCCTTTCATTTTCTGAAGAAAAGATTCTGGCAACT
CGCGGACATCGACTGAAGATCCTGGTTGAACCGGGTAGGGCAATCACCAGTGGATGCCCT
AGTGGTAAGGTGGTAGTTTCCCCAAGGCATTTTCTCACCAAAATTCAAGCATCTTTGTGC
TCTGGTTCCATCAGCAAGAGAAAGCTCAGTATTTCTGATGATCAGGAAAAGCTACAAGAG
TCGCCAAGCAGTTCAAAGCGACTGCACAGAACATCGAGTGTACCATTCGACCTGAACCTC
CCTGTTGATGAAGATGAACCCCTTGATGCTGATGACGACAGTAGTAGCCATGAAAATTCA
TATGGCAACACAGAAAAATCCATTGATGCCCTTTTGCATTCGGTTGATGGATCAATCAAC
TTTAAGCCGTTTGACTTTGATAAACTTGCTGATGACATGCTGCAGGAGTTCAGCAACATA
CTCAGGAAAAATCTGGGTTCTGAGTGCATGTTGGAGATTGATGTTGGTGCAATGGAACAA
ATACTTGCCGCAGCATGGAAATCAGAGGAGGATAGGAAACCTGTGCCGACCTGGCTGGAG
CAGGTTTTTGCCAGGAGCCTTGACGAGCTGAAGCTCAAGCGTAAGCATGTGAGTAGCTCT
ACCCTTAGACTAGTGGCCTGTGAGGACACAGTACCAGCAGTGAAAGGAGACGGTTTAGGA
GTTTTGCTCCCGCCAAGAATAATTCTAGATTGTTGA

CDS

3396 bp

>Os11t0104300-01 Substrate of the SCFD3 ubiquitination complex, Repressor of strigolactone (SL) signalling
ATGCCCACTccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctc
gacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctc
atctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcc
cgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtc
tccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgag
ccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgc
aacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtc
aaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtc
ttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccg
cccatgccgctcctcggccgcctccccaCGCGCACCCGTCCGCCGCCTCTCTTCCTCTGC
AGCTTCGCCGCCGCGGACGACGCCGACGTCCCTTCGCCGGCCGGGAATCTCGCCGGCGCG
GGGGAGGAGAACTGCCGCCGCATCGCGGAGATCCTCTCCCGCGGCCGCAACCCCATGCTC
GTCGGCGTCGGGGCCGCCTCCGCCGCCGACGACTTCGCGGCCGCCTCCCCGTATCGTATC
ATCCATGTCGACCCCAACACCATCGACCGCTCAGACCTCGGCGTGGCGGCGGCAATGGCC
AGTGCCACCTCCGGCCTCATCATAAGCATCGGAGACCTCAAGCAGCTGGTCCCCGATGAG
GACGCGGAGGCGCAGGAGAAGGGGCGGCGGGTGGTGGCGGAGGTGACGCGAGTGCTGGAG
ACGCACAGCAAGGTCGGCCGCGTCTGGGTGATGGGGTGGTCGGCAACGTACGAGACCTAC
CTCGCCTTCCTCTCCAAATTCCCCTTGGTCGACAAGGATTGGGACCTCCAGCTGCTGCCA
ATCACCGCGGTGCATGCCGCCGCCACCGCTGGCCCTGCTGCTGCTGCTGCTGGACTCATG
CCTCCGGCAACCACTGTTGCTGCCTTCTCCAAGCCAGCTGCAAGCTTGATGGACTCCTTT
GTTCCTTTTGGAGGCTTTCTCTGTGATAACTACGAAGAGAACAGCCTGACAGCAAATTCA
TGCCCACAGGCCCTGCGGTGCCAGCAGTGCAATGATAAATATGAGCAAGAAGTTGCAACT
ATCATTAGCGCAAGTGGCATTACAGCTGAAGACCATCACCAGGGAGGTCTTCCTTCCCTG
CTGCAGAATGGCAGCATGATGGGTCCTAACAATGGATTTGATCCAGTCAAGGCTAGAGAT
GATCGGATGGTATTGAATTCAAAAATATTGAATCTACGGAAGAAGTGGAATGAGTACTGC
CTGCGGCTCCACCAAGACCACCAGAGGATCAACAGAGATCCTTACAAACCATTTCCGCGC
TATATTGGTGTTCCCACTGACAAAGAAAGATCAGCAAATTCAAGCAAAGGTTCTGAGTCA
GTTGGGGTTCAAAAGGATGTTATTAAACCTTGTGCGGTGTCTGCTGTACATTCCAGCTCA
ACTGCAAGGCCTATTTCATCTCCATCTGTCACCAACAAAAGAAATGAAGATCTTGTATTG
AACCTTCAAGCCAGGCATTCCAAGAGTGATGAAAACCTTCAAGAAAGGGGCATGCAATCC
CAACATGGCACCCTGTCGAATGTTGACAATCCGGATGATCATGTCTCACCATCATCTGCT
GCACCTGTGGAAACTGACTTGGTTTTGGGCACCCCTCGAGAGTGTAGTTCGAAAGGTTCA
AGTTCCACCTGCAGTAAACGTGTAGAGGATTCAGAGAGGTCTGTCCATCTGGTACCCAAG
AAGGTGGATGATTTAAATCTGAAGCATCCACAACTCTCTGTTCAACCTAATTCCTGCTCC
TGGAGTTCCATAAATGTTGGGAAAACATCACACAGTACACTACACTCAGTAGCTTCAGGA
GGCTTCTCTGCCTTTGGCCAATGGCAGAAACGGTCACCTCTTGCTGCACAAAATTCTGAT
CTGAGCAATTACAAGCTACTTGTTGAACGCCTGTTCAAGGTAGTTGGAAGGCAGGAGGAA
GCCTTGAGTGCTATTTGTGAATCCATTGTGCGGTGCCGGTCAACAGAGTCGCGCCGTGGT
CCTAACAGGAATGACATCTGGTTGTGTTTTCATGGTTCTGACAGCATGGCCAAGAAGAGA
ATCGCCGTGGCACTTGCAGAGCTCATGCACGGCAGCAAAGATAACTTGATTTATCTGGAC
CTAAACCTTCAGGATTGGGATGACTCCAGTTTCAGAGGGAAGACTGGCATAGACTGCATT
GTGGAGCAGTTGAGCAAGAAACGGCAATCTGTTCTCTTCCTTGACAACATTGATAGAGCT
GACTGCCTTGTTCAGGATAGTCTATCTGATGCTATTAAGTCTGGCAGGTTCCAAGACATG
CGAGGCAAGGTGGTTGACATTAATGACTCGATTGTGGTTTTGTCAAGAAGCATGATACAG
GGCAGCAAAAATGGGTTGGAAGAGGGCCTTTCATTTTCTGAAGAAAAGATTCTGGCAACT
CGCGGACATCGACTGAAGATCCTGGTTGAACCGGGTAGGGCAATCACCAGTGGATGCCCT
AGTGGTAAGGTGGTAGTTTCCCCAAGGCATTTTCTCACCAAAATTCAAGCATCTTTGTGC
TCTGGTTCCATCAGCAAGAGAAAGCTCAGTATTTCTGATGATCAGGAAAAGCTACAAGAG
TCGCCAAGCAGTTCAAAGCGACTGCACAGAACATCGAGTGTACCATTCGACCTGAACCTC
CCTGTTGATGAAGATGAACCCCTTGATGCTGATGACGACAGTAGTAGCCATGAAAATTCA
TATGGCAACACAGAAAAATCCATTGATGCCCTTTTGCATTCGGTTGATGGATCAATCAAC
TTTAAGCCGTTTGACTTTGATAAACTTGCTGATGACATGCTGCAGGAGTTCAGCAACATA
CTCAGGAAAAATCTGGGTTCTGAGTGCATGTTGGAGATTGATGTTGGTGCAATGGAACAA
ATACTTGCCGCAGCATGGAAATCAGAGGAGGATAGGAAACCTGTGCCGACCTGGCTGGAG
CAGGTTTTTGCCAGGAGCCTTGACGAGCTGAAGCTCAAGCGTAAGCATGTGAGTAGCTCT
ACCCTTAGACTAGTGGCCTGTGAGGACACAGTACCAGCAGTGAAAGGAGACGGTTTAGGA
GTTTTGCTCCCGCCAAGAATAATTCTAGATTGTTGA

Protein

1132 aa

>Os11t0104300-01 Substrate of the SCFD3 ubiquitination complex, Repressor of strigolactone (SL) signalling
MPTPVAAARQCLSPAAVPALDAAVASSRRRAHAQTTSLHLISSLLAPPAPPLLRDALARA
RSAAYSPRVQLKALDLCFAVSLDRLPSVSASSSSSGAADEPPVSNSLMAAIKRSQANQRR
NPDTFHFYHQAATAQTPAAVKVELSHLVLAILDDPVVSRVFAEAGFRSGDIKLAILRPAP
PMPLLGRLPTRTRPPPLFLCSFAAADDADVPSPAGNLAGAGEENCRRIAEILSRGRNPML
VGVGAASAADDFAAASPYRIIHVDPNTIDRSDLGVAAAMASATSGLIISIGDLKQLVPDE
DAEAQEKGRRVVAEVTRVLETHSKVGRVWVMGWSATYETYLAFLSKFPLVDKDWDLQLLP
ITAVHAAATAGPAAAAAGLMPPATTVAAFSKPAASLMDSFVPFGGFLCDNYEENSLTANS
CPQALRCQQCNDKYEQEVATIISASGITAEDHHQGGLPSLLQNGSMMGPNNGFDPVKARD
DRMVLNSKILNLRKKWNEYCLRLHQDHQRINRDPYKPFPRYIGVPTDKERSANSSKGSES
VGVQKDVIKPCAVSAVHSSSTARPISSPSVTNKRNEDLVLNLQARHSKSDENLQERGMQS
QHGTLSNVDNPDDHVSPSSAAPVETDLVLGTPRECSSKGSSSTCSKRVEDSERSVHLVPK
KVDDLNLKHPQLSVQPNSCSWSSINVGKTSHSTLHSVASGGFSAFGQWQKRSPLAAQNSD
LSNYKLLVERLFKVVGRQEEALSAICESIVRCRSTESRRGPNRNDIWLCFHGSDSMAKKR
IAVALAELMHGSKDNLIYLDLNLQDWDDSSFRGKTGIDCIVEQLSKKRQSVLFLDNIDRA
DCLVQDSLSDAIKSGRFQDMRGKVVDINDSIVVLSRSMIQGSKNGLEEGLSFSEEKILAT
RGHRLKILVEPGRAITSGCPSGKVVVSPRHFLTKIQASLCSGSISKRKLSISDDQEKLQE
SPSSSKRLHRTSSVPFDLNLPVDEDEPLDADDDSSSHENSYGNTEKSIDALLHSVDGSIN
FKPFDFDKLADDMLQEFSNILRKNLGSECMLEIDVGAMEQILAAAWKSEEDRKPVPTWLE
QVFARSLDELKLKRKHVSSSTLRLVACEDTVPAVKGDGLGVLLPPRIILDC*

CDS

chr11:194381..195564 (+ strand) : 1184 bp

chr11:196724..196970 (+ strand) : 247 bp

chr11:197097..199061 (+ strand) : 1965 bp

FASTA

>Os11t0104300-01 class=Sequence position=chr11:194381..199061 (+ strand)
ATGCCCACTc cggtggccgc cgcgaggcag tgcctctcgc cggccgccgt ccccgccctc gacgccgccg tcgcctcctc
tcgccgccgc gcccacgccc agactacctc cctccacctc atctcctccc tcctcgcccc gcccgcacct cccctcctcc
gcgacgccct cgcccgcgcc cgcagcgccg cctactcacc ccgcgtccag ctcaaggccc tcgacctctg cttcgccgtc
tccctcgaca ggctcccctc cgtctccgca tcctcctcct cctctggcgc cgccgacgag ccccccgtct ccaactccct
catggccgcc atcaagcgct cccaggccaa ccagcgccgc aacccggaca ccttccactt ctatcaccag gccgccaccg
cccagactcc cgccgccgtc aaggtcgagc tctcccacct cgtcctcgcc atcctcgatg accccgtcgt cagccgcgtc
ttcgccgagg ccggattccg cagcggggac atcaagctcg ccatcctccg cccggctccg cccatgccgc tcctcggccg
cctccccaCG CGCACCCGTC CGCCGCCTCT CTTCCTCTGC AGCTTCGCCG CCGCGGACGA CGCCGACGTC CCTTCGCCGG
CCGGGAATCT CGCCGGCGCG GGGGAGGAGA ACTGCCGCCG CATCGCGGAG ATCCTCTCCC GCGGCCGCAA CCCCATGCTC
GTCGGCGTCG GGGCCGCCTC CGCCGCCGAC GACTTCGCGG CCGCCTCCCC GTATCGTATC ATCCATGTCG ACCCCAACAC
CATCGACCGC TCAGACCTCG GCGTGGCGGC GGCAATGGCC AGTGCCACCT CCGGCCTCAT CATAAGCATC GGAGACCTCA
AGCAGCTGGT CCCCGATGAG GACGCGGAGG CGCAGGAGAA GGGGCGGCGG GTGGTGGCGG AGGTGACGCG AGTGCTGGAG
ACGCACAGCA AGGTCGGCCG CGTCTGGGTG ATGGGGTGGT CGGCAACGTA CGAGACCTAC CTCGCCTTCC TCTCCAAATT
CCCCTTGGTC GACAAGGATT GGGACCTCCA GCTGCTGCCA ATCACCGCGG TGCATGCCGC CGCCACCGCT GGCCCTGCTG
CTGCTGCTGC TGGACTCATG CCTCCGGCAA CCACTGTTGC TGCCTTCTCC AAGCCAGCTG CAAGGTCAAG CCTTTTCTCT
TCTCTTCTCT TCACTTTTGT ATCCATGAAT TCTTTATGCA TAAGATTTTA TTACCATCCA TTTGCTGACT GCCGTGCTTT
CTTTATTGTC AGAATGTTTC TTGGATAGTA GTGTATCTGA TTAGGTGTGC TAGTACGATT TGCTTATGTT CTTTACTAAT
TTCATTTTTT TTAAGTGTTG ATTTGTGTGC TTTGCCCATT GTATGGATAT TTTTTTCAAC TTGTGCAATT GATTTAGTGT
ACTACTGTAA TTAGAAGCAG CATAGGTTGT TAAAAAGGCA TAAATCTAGA AAGGTTTGTT TTCTTCCACT GCATTTTTTT
TAAAAATGTT TTTACACGGT CAATGATGTA CAACCGTTTT TGTTTAATGC GATGGTTGAG TTATGTTCTA AGTGCCATGT
TACTCCTGTT ATGTTCTTGT TGAGTTATGA CCGATTCAGT TCTGTTAAGT ACGACAGGAG TTGCTGGAAA TTTTCTCTTC
TCAGAAGTGG GTTCCTAATG TGTTGTCATC AGAACCTTCC AGACCAACTT CCTTCTAGAT GCTCTGCTGT TAGTCACTAC
CTGTGTTATT TACTGATTTC TCAGCTCTTT TTTCTTTTTT GCCTTTAGGA TATTTAATGG GATTTTCTTC TTATAAGCCT
TTTCTCTGTA GTCCTATTCT TGTAATATTT TTGGATTTTA TTACTACATA TGTGTGGCCA TGAAGGAGAG GTTCTATTGC
CGGTGCAGAA TCCATATGCA TACACATTTT GAACTGCTTG ATAAAGAGAG ACTAAAGTGT AAAAGTAAAA TAATACAGCT
TGTGTACTAA GAGATGCAAT TTCATGGTAA AAGAGTGGTG CTTCTGCTGC AGCACATCTG TTCTTTACTG CTGTAATGCT
CAAATTGCTG ATAGTTTGGG TCATATATGT GGGCAGAGAT TATTTGTCAT TAATATGTAG TATCACCTAT AGTGAATTAC
CTTGATGCAT AGGGCTAGTG ATTTCTGTCA CAACATAGTA TTGTATGGCA TTTTATTCAG CTGTAGAAAT GTTAATGCTT
AAGCGTTGCT GGTATTAATG ACAAAGTGAC ATATACATAA CTCCAATATA AAGCAACGAT ATGCTTGTGT CTTGACCTCA
TAGTTTCAAA CTTGTTATTG CAGCTTGATG GACTCCTTTG TTCCTTTTGG AGGCTTTCTC TGTGATAACT ACGAAGAGAA
CAGCCTGACA GCAAATTCAT GCCCACAGGC CCTGCGGTGC CAGCAGTGCA ATGATAAATA TGAGCAAGAA GTTGCAACTA
TCATTAGCGC AAGTGGCATT ACAGCTGAAG ACCATCACCA GGGAGGTCTT CCTTCCCTGC TGCAGAATGG CAGCATGATG
GGTCCTAACA ATGGATTTGA TCCAGTCAAG GTGTGAAGCT ACCTATGTCT TTTGGAACAT TTATGTTAAG TACTGAACGC
AGCAAGCACT GCTTGTTGAT AGATGAATAA TTTTTGGTCG TTGGTATAAA AGATGCACAG TTTTTTTTCA GTGCAGGCTA
GAGATGATCG GATGGTATTG AATTCAAAAA TATTGAATCT ACGGAAGAAG TGGAATGAGT ACTGCCTGCG GCTCCACCAA
GACCACCAGA GGATCAACAG AGATCCTTAC AAACCATTTC CGCGCTATAT TGGTGTTCCC ACTGACAAAG AAAGATCAGC
AAATTCAAGC AAAGGTTCTG AGTCAGTTGG GGTTCAAAAG GATGTTATTA AACCTTGTGC GGTGTCTGCT GTACATTCCA
GCTCAACTGC AAGGCCTATT TCATCTCCAT CTGTCACCAA CAAAAGAAAT GAAGATCTTG TATTGAACCT TCAAGCCAGG
CATTCCAAGA GTGATGAAAA CCTTCAAGAA AGGGGCATGC AATCCCAACA TGGCACCCTG TCGAATGTTG ACAATCCGGA
TGATCATGTC TCACCATCAT CTGCTGCACC TGTGGAAACT GACTTGGTTT TGGGCACCCC TCGAGAGTGT AGTTCGAAAG
GTTCAAGTTC CACCTGCAGT AAACGTGTAG AGGATTCAGA GAGGTCTGTC CATCTGGTAC CCAAGAAGGT GGATGATTTA
AATCTGAAGC ATCCACAACT CTCTGTTCAA CCTAATTCCT GCTCCTGGAG TTCCATAAAT GTTGGGAAAA CATCACACAG
TACACTACAC TCAGTAGCTT CAGGAGGCTT CTCTGCCTTT GGCCAATGGC AGAAACGGTC ACCTCTTGCT GCACAAAATT
CTGATCTGAG CAATTACAAG CTACTTGTTG AACGCCTGTT CAAGGTAGTT GGAAGGCAGG AGGAAGCCTT GAGTGCTATT
TGTGAATCCA TTGTGCGGTG CCGGTCAACA GAGTCGCGCC GTGGTCCTAA CAGGAATGAC ATCTGGTTGT GTTTTCATGG
TTCTGACAGC ATGGCCAAGA AGAGAATCGC CGTGGCACTT GCAGAGCTCA TGCACGGCAG CAAAGATAAC TTGATTTATC
TGGACCTAAA CCTTCAGGAT TGGGATGACT CCAGTTTCAG AGGGAAGACT GGCATAGACT GCATTGTGGA GCAGTTGAGC
AAGAAACGGC AATCTGTTCT CTTCCTTGAC AACATTGATA GAGCTGACTG CCTTGTTCAG GATAGTCTAT CTGATGCTAT
TAAGTCTGGC AGGTTCCAAG ACATGCGAGG CAAGGTGGTT GACATTAATG ACTCGATTGT GGTTTTGTCA AGAAGCATGA
TACAGGGCAG CAAAAATGGG TTGGAAGAGG GCCTTTCATT TTCTGAAGAA AAGATTCTGG CAACTCGCGG ACATCGACTG
AAGATCCTGG TTGAACCGGG TAGGGCAATC ACCAGTGGAT GCCCTAGTGG TAAGGTGGTA GTTTCCCCAA GGCATTTTCT
CACCAAAATT CAAGCATCTT TGTGCTCTGG TTCCATCAGC AAGAGAAAGC TCAGTATTTC TGATGATCAG GAAAAGCTAC
AAGAGTCGCC AAGCAGTTCA AAGCGACTGC ACAGAACATC GAGTGTACCA TTCGACCTGA ACCTCCCTGT TGATGAAGAT
GAACCCCTTG ATGCTGATGA CGACAGTAGT AGCCATGAAA ATTCATATGG CAACACAGAA AAATCCATTG ATGCCCTTTT
GCATTCGGTT GATGGATCAA TCAACTTTAA GCCGTTTGAC TTTGATAAAC TTGCTGATGA CATGCTGCAG GAGTTCAGCA
ACATACTCAG GAAAAATCTG GGTTCTGAGT GCATGTTGGA GATTGATGTT GGTGCAATGG AACAAATACT TGCCGCAGCA
TGGAAATCAG AGGAGGATAG GAAACCTGTG CCGACCTGGC TGGAGCAGGT TTTTGCCAGG AGCCTTGACG AGCTGAAGCT
CAAGCGTAAG CATGTGAGTA GCTCTACCCT TAGACTAGTG GCCTGTGAGG ACACAGTACC AGCAGTGAAA GGAGACGGTT
TAGGAGTTTT GCTCCCGCCA AGAATAATTC TAGATTGTTG A

Locus: Os11g0104300

Loading...

Locus: Os11g0104300

Loading...