Os11t0105800-01

Locus

Os11g0105800

Description

Phosphatidate cytidylyltransferase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK110748 (DDBJ, Best hit)

Protein Evidence

Q2QYV3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Phosphatidate cytidylyltransferase (IPR000374)

Full-length cDNA

002-170-G04 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0105800-01)

RiceXPro (AK110748)

Others

KEGG (Os11t0105800-01)

Transcript

1115 bp

>Os11t0105800-01 Phosphatidate cytidylyltransferase family protein.
AATAATCCAAGGTCAGCCACACCCTTAATACATACAGTATGTAAAATCTGAGTTTGTGGC
CGCTCCGCTAGCAAGGCCTCATCCATGTGGATTCTGGAGAGCCCGCTGCTCCGGGACGCC
GGCGCCGCCGTGCTCACCGGAGCCACCGCCCTCGCCGTGCTTCGTTTCTGGGAAGAGGTC
GGCAACCGCGCCCTCTTGGACCAGAAACTCTGCAGGAAACTCGTGCATATTACTGTTGGC
TTAGTATACTTCCTTATGTGGCCTTTGTTCAGTGCGGATGATGTCTATGCTCCATTTCTT
GCTTCCCTTGTCATTGCATTCAACATCATAAAGGTTACCTTGATTGGACTTGGTATTGTC
AAAGATGATGGCGTCATTAACTCCATGACCAGGAACGGAGACCGCAGAGAGCTTCTTAAA
GGTCCACTGTACTACGCTTGTGCTATAACACTCGCTACTGTAATTTTCTGGAGGACATCT
CCCATTTCAATCGCAGTGATTTGCAACTTGTGTGCCGGAGATGGTGTAGCTGACATAGCT
GGAAGGCGATTCGGACATGTAAAGCTTCCTTACAACCCTGATAAGTCTTATGCTGGATCC
ATTGCAATGTTCTTAGCTGGTTTCCTTGCATCAATCCTGTACATGTGCTACTTCCACCTC
TTTGGATTTGTCGAGGAGAGCTGGAGCATGGTGATCGCCTTTGGTGTGACATCGCTTGCT
GCTGCAATTGTGGAGTCACTCCCTATCAGCACACGCCTGGACGACAATCTGACTGTGCCA
CTCGCCTCTGTCCTCGTTGGTGTCCTTGTTTTCTATTATACTGGGGCCAGAAACCTGTGT
TGTATGAGCGCTGACAGCAGTGACATTTCTGCACTTGTGCAGAATCAGATGGTCTTGGAC
AGGTTCTAGTGACTACTGACTAGTAAGTAGCTGCCCTGCAGAGCTGAAAAGAAACTGATT
TACTAATATCAGATTTGATTAATGTAACAAGGATCGATACAAGCTACAAGCATCATAGTT
GTATCTTGTAATCAAGAAAAACAAAAGCTATCTGATATACTAGTAAGGCAAAAGTTGAGT
AGAGGAAAAACATACCAGAGAGCTGTCTACACTCC

CDS

825 bp

>Os11t0105800-01 Phosphatidate cytidylyltransferase family protein.
ATGTGGATTCTGGAGAGCCCGCTGCTCCGGGACGCCGGCGCCGCCGTGCTCACCGGAGCC
ACCGCCCTCGCCGTGCTTCGTTTCTGGGAAGAGGTCGGCAACCGCGCCCTCTTGGACCAG
AAACTCTGCAGGAAACTCGTGCATATTACTGTTGGCTTAGTATACTTCCTTATGTGGCCT
TTGTTCAGTGCGGATGATGTCTATGCTCCATTTCTTGCTTCCCTTGTCATTGCATTCAAC
ATCATAAAGGTTACCTTGATTGGACTTGGTATTGTCAAAGATGATGGCGTCATTAACTCC
ATGACCAGGAACGGAGACCGCAGAGAGCTTCTTAAAGGTCCACTGTACTACGCTTGTGCT
ATAACACTCGCTACTGTAATTTTCTGGAGGACATCTCCCATTTCAATCGCAGTGATTTGC
AACTTGTGTGCCGGAGATGGTGTAGCTGACATAGCTGGAAGGCGATTCGGACATGTAAAG
CTTCCTTACAACCCTGATAAGTCTTATGCTGGATCCATTGCAATGTTCTTAGCTGGTTTC
CTTGCATCAATCCTGTACATGTGCTACTTCCACCTCTTTGGATTTGTCGAGGAGAGCTGG
AGCATGGTGATCGCCTTTGGTGTGACATCGCTTGCTGCTGCAATTGTGGAGTCACTCCCT
ATCAGCACACGCCTGGACGACAATCTGACTGTGCCACTCGCCTCTGTCCTCGTTGGTGTC
CTTGTTTTCTATTATACTGGGGCCAGAAACCTGTGTTGTATGAGCGCTGACAGCAGTGAC
ATTTCTGCACTTGTGCAGAATCAGATGGTCTTGGACAGGTTCTAG

Protein

275 aa

>Os11t0105800-01 Phosphatidate cytidylyltransferase family protein.
MWILESPLLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWP
LFSADDVYAPFLASLVIAFNIIKVTLIGLGIVKDDGVINSMTRNGDRRELLKGPLYYACA
ITLATVIFWRTSPISIAVICNLCAGDGVADIAGRRFGHVKLPYNPDKSYAGSIAMFLAGF
LASILYMCYFHLFGFVEESWSMVIAFGVTSLAAAIVESLPISTRLDDNLTVPLASVLVGV
LVFYYTGARNLCCMSADSSDISALVQNQMVLDRF*

5'UTR

chr11:264410..264493 (- strand) : 84 bp

CDS

chr11:264290..264409 (- strand) : 120 bp

chr11:263967..264034 (- strand) : 68 bp

chr11:263711..263845 (- strand) : 135 bp

chr11:263453..263568 (- strand) : 116 bp

chr11:263193..263307 (- strand) : 115 bp

chr11:262829..263099 (- strand) : 271 bp

3'UTR

chr11:262623..262828 (- strand) : 206 bp

FASTA

>Os11t0105800-01 class=Sequence position=chr11:262623..264493 (- strand)
AATAATCCAA GGTCAGCCAC ACCCTTAATA CATACAGTAT GTAAAATCTG AGTTTGTGGC CGCTCCGCTA GCAAGGCCTC
ATCCATGTGG ATTCTGGAGA GCCCGCTGCT CCGGGACGCC GGCGCCGCCG TGCTCACCGG AGCCACCGCC CTCGCCGTGC
TTCGTTTCTG GGAAGAGGTC GGCAACCGCG CCCTCTTGGA CCAGGTCACC TCACCTCTTC TTCCTTCACC TACTCTCTTA
ACGGTTGCTC ACTTCAGCTC TCTGTAGCAT GATATGACTA GTGTGTTTAG ATCCCTATTA GCTGCCGGCA AATTTCCATA
AGCACACCAT TAATTTGTTG GTTAATTGAG GTGTTTGTGT CAGATCCTGT GTTAGTCACA TCACATATAT ACTGCAGCAT
GTCTTTCCGC AGCAATTATG CTGATTCTTG ACTGGTATGT CGGGCTTGTC CATCTTCAGA AACTCTGCAG GAAACTCGTG
CATATTACTG TTGGCTTAGT ATACTTCCTT ATGTGGCCTT TGTTCAGGTA AACCAGATCG ATCGAGTTCC AGACCAACAA
TATACTAGCA GTATCTTTAA TTTTGTCATG TCATAGCCAT ACCAAGTGTG TTTCTGCCTT CCTGACAACG TACTCTTCCT
GATTGCAGTG CGGATGATGT CTATGCTCCA TTTCTTGCTT CCCTTGTCAT TGCATTCAAC ATCATAAAGG TTACCTTGAT
TGGACTTGGT ATTGTCAAAG ATGATGGCGT CATTAACTCC ATGACCAGGA ACGGAGACCG CAGGTACTCA TCTCATTTCC
CCCCTTTGAC AAGCTAGTGG GCAAAGAAAG ATTTGGCATT CTTACGCATT ACTGCAATAA AAATAATAAT AATCATAGTT
GTGTTGCTTC TACCACTTGA TTCAGTAATC CCTTTTTGTT TCCAGAGAGC TTCTTAAAGG TCCACTGTAC TACGCTTGTG
CTATAACACT CGCTACTGTA ATTTTCTGGA GGACATCTCC CATTTCAATC GCAGTGATTT GCAACTTGTG TGCCGGAGAT
GGTACGGCCT TAGCTTCATC TAATCTCCTG CAGTTGAAAA TTTTCTGCTG ATACTGACAC TGTTCTATCG ATTTTGGACT
GCTCCTTTCA TTCACCGAGT GAAAAGTTTC AGACGTCAAC TGACTTCTCT ACACTGCTTC TTTCAGGTGT AGCTGACATA
GCTGGAAGGC GATTCGGACA TGTAAAGCTT CCTTACAACC CTGATAAGTC TTATGCTGGA TCCATTGCAA TGTTCTTAGC
TGGTTTCCTT GCATCAATCC TGTAAGTAAC AAGTTGGAGT ATCTAATAGG CTACCCTACA TTTCTATTGA AGTCTTGGTA
GCTGTTAATC TGAAACTGCT GGAGTACTTG CTAGGTACAT GTGCTACTTC CACCTCTTTG GATTTGTCGA GGAGAGCTGG
AGCATGGTGA TCGCCTTTGG TGTGACATCG CTTGCTGCTG CAATTGTGGA GTCACTCCCT ATCAGCACAC GCCTGGACGA
CAATCTGACT GTGCCACTCG CCTCTGTCCT CGTTGGTGTC CTTGTTTTCT ATTATACTGG GGCCAGAAAC CTGTGTTGTA
TGAGCGCTGA CAGCAGTGAC ATTTCTGCAC TTGTGCAGAA TCAGATGGTC TTGGACAGGT TCTAGTGACT ACTGACTAGT
AAGTAGCTGC CCTGCAGAGC TGAAAAGAAA CTGATTTACT AATATCAGAT TTGATTAATG TAACAAGGAT CGATACAAGC
TACAAGCATC ATAGTTGTAT CTTGTAATCA AGAAAAACAA AAGCTATCTG ATATACTAGT AAGGCAAAAG TTGAGTAGAG
GAAAAACATA CCAGAGAGCT GTCTACACTC C

Locus: Os11g0105800

Loading...

Locus: Os11g0105800

Loading...