Os11t0109900-01

Locus

Os11g0109900

Description

Double-stranded RNA-binding-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DRB1A

CGSNL Gene Name

DSRNA-BINDING PROTEIN 1A

Oryzabase Gene Symbol Synonym(s)

OsDRB1a, DRB1a

Oryzabase Gene Name Synonym(s)

dsRNA-binding protein 1a

Transcript Evidence

AK063961 (DDBJ, Best hit)

AK121852 (DDBJ, Best hit)

Protein Evidence

Q0IV63 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: rRNA catabolic process (GO:0016075)

Cellular Component: intracellular (GO:0005622)

Molecular Function: RNA binding (GO:0003723)

Molecular Function: double-stranded RNA binding (GO:0003725)

Molecular Function: ribonuclease III activity (GO:0004525)

Functional domain (InterPro)

Double-stranded RNA-binding (IPR001159)

Ribonuclease III, bacterial (IPR011907)

Double-stranded RNA-binding-like (IPR014720)

Full-length cDNA

001-123-G10 (Online Clone Ordering)

J033101N14 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0109900-01)

Others

Oryzabase (22063)

Transcript

1829 bp

>Os11t0109900-01 Double-stranded RNA-binding-like domain containing protein.
ATCGCACCACGCACACAACCAAAACCCTTCTCTTCTCTCTCGACTCTCGACGACGCTGCG
GCGGCGGTGGCGGCGAGGTGGGAATGGACATGCCGCCCACGCCCCTTCCGCCGGAGACCG
CCAACACCTCGCCCGCTCCCAACGGCGCCACCGCCGGAATCAGGGTTGAGAACTGCTACG
TCTTCAAGAGCCGGCTGCAAGAGTATGCGCAGAAAGCCGGCCTCCAGACTCCAGAGTATC
ATACCTTCAAGGAGGGACCTTCCCATGAGCCTGTCTTCAAGTCCACAGTGGTGATTAATA
ACACCAGCTATGACTCCCTGCCCGGATTCTTCAACAGAAAGGCTGCAGAACAGTCTGCTG
CTGAAGTTGCCCTCATGGAAATTGTCAAGTCCATACCAGCCAACGCAAACATCCCAGCTG
TTCAAGAGACTGGGCTGTGCAAGAATCTTCTTCAGGAGTATGCACAGAAGATGAATTATG
CCATTCCATCTTATATTTGCACCAAATCAGCCTCAGGCTTAGCTCCTTTCATATGCACTG
TAGAGATTGGTGGAATACAATATATTGGTGCTGCAGCCAGAACAAAGAAAGATGCAGAGA
TAAAAGCTGCTCGAACTGCTCTTCTGGCAATTCAAGGTCAATCAGAGGGTTCTGCAAATG
GTGCGACAAAATATATTGTAGTTCCTGGTAAAAGGGTAGGTAAGGAGGTAGAGAAAATGC
CAATTGAAACCCCCAAACCACTTAAAATAAAGAAAGGTGGTTTCAAGAAGAAATGGAACA
AGAGGAAATTCATGAAGAAGGATGGTCAAGCTGTTGTGGAAAAGGATGAAGCTAGAGTGG
CTGGAGATGCTCACGATTCTGACGTCCTAATGCAGCCAACAGTAATAACACAGGAGGCAT
CTTGTGGCACTCTGTTCCTTCAACCTTGTGAGGAAGCTAAAAGAGTAGAAGCTGAGCCAC
CTAGAGATATTGAAATGGTACAACCTGATAAGGAGAACCAACACAGTGACGCTGCATTGG
TGCAACCTGATGATGAAGCTAGAGTAGAACAGGAGCCATCCAGAGATATTTCAGTGGTGC
CACCTAATGAGGAAGCTATAAGTGTTAAGCAGGAACCATCCATCGATGCTGCAATTCTGC
AACCTAAAGAGGAAGCTTCAAGTGTAAAGCAGGAGCCATTCATCGATACTGCAATGCTGC
AAGCTTGTAAGGAAGCTGGAAGTGTAGAACTTGGGCCAGCCAGAGATACTGTAATTTCTC
AACTTAATGAGCAAGATAGGGGTGTAAAGCAGGAGCCAGCTGGTGACACTGCAGTGCCAC
AACCTGACGTGGACGCTAGGGTCGTAAAGGAGGAGTCACCAAGAACGGAACCTAATGGGG
AAGCTACGAACATGAAGGAGACACCAAAGAACTCTGCAGTGTGTAATTCTCCAGAGACAA
AGGAATTTGGAGATATTACAGCAATGGGTTCAGATCCTCCCGCAACTAATATGAGCGAAG
AATAAGCTGTGGTTGTTGAATCAAAATGCAATAGCTTTAGTGTGTTCACCTGCAGAGGGC
GAAGAATAAGCTGCGGTTGTTGAATCAAAATGCAATAGCCTTAGTGTGTTCACCTGCAGA
GGTGTGAAACATGAATGGCTGGCTTTTCCAGTTTAAAAAGAGGCAGCTGGAATAGGAAGA
TGTATGTGGGCTGAGAATAGTTAGTTCATATTTGTCATTGTTAGCTAGGCATGTGTATGC
CTGATGATATGAATGAAATGTATTACCTGCTGCTTTAGTGAGCACTACTTTGAAAAGAAG
GGGAAAAAATGAATTCGAGGTTTCTGATC

CDS

1422 bp

>Os11t0109900-01 Double-stranded RNA-binding-like domain containing protein.
ATGGACATGCCGCCCACGCCCCTTCCGCCGGAGACCGCCAACACCTCGCCCGCTCCCAAC
GGCGCCACCGCCGGAATCAGGGTTGAGAACTGCTACGTCTTCAAGAGCCGGCTGCAAGAG
TATGCGCAGAAAGCCGGCCTCCAGACTCCAGAGTATCATACCTTCAAGGAGGGACCTTCC
CATGAGCCTGTCTTCAAGTCCACAGTGGTGATTAATAACACCAGCTATGACTCCCTGCCC
GGATTCTTCAACAGAAAGGCTGCAGAACAGTCTGCTGCTGAAGTTGCCCTCATGGAAATT
GTCAAGTCCATACCAGCCAACGCAAACATCCCAGCTGTTCAAGAGACTGGGCTGTGCAAG
AATCTTCTTCAGGAGTATGCACAGAAGATGAATTATGCCATTCCATCTTATATTTGCACC
AAATCAGCCTCAGGCTTAGCTCCTTTCATATGCACTGTAGAGATTGGTGGAATACAATAT
ATTGGTGCTGCAGCCAGAACAAAGAAAGATGCAGAGATAAAAGCTGCTCGAACTGCTCTT
CTGGCAATTCAAGGTCAATCAGAGGGTTCTGCAAATGGTGCGACAAAATATATTGTAGTT
CCTGGTAAAAGGGTAGGTAAGGAGGTAGAGAAAATGCCAATTGAAACCCCCAAACCACTT
AAAATAAAGAAAGGTGGTTTCAAGAAGAAATGGAACAAGAGGAAATTCATGAAGAAGGAT
GGTCAAGCTGTTGTGGAAAAGGATGAAGCTAGAGTGGCTGGAGATGCTCACGATTCTGAC
GTCCTAATGCAGCCAACAGTAATAACACAGGAGGCATCTTGTGGCACTCTGTTCCTTCAA
CCTTGTGAGGAAGCTAAAAGAGTAGAAGCTGAGCCACCTAGAGATATTGAAATGGTACAA
CCTGATAAGGAGAACCAACACAGTGACGCTGCATTGGTGCAACCTGATGATGAAGCTAGA
GTAGAACAGGAGCCATCCAGAGATATTTCAGTGGTGCCACCTAATGAGGAAGCTATAAGT
GTTAAGCAGGAACCATCCATCGATGCTGCAATTCTGCAACCTAAAGAGGAAGCTTCAAGT
GTAAAGCAGGAGCCATTCATCGATACTGCAATGCTGCAAGCTTGTAAGGAAGCTGGAAGT
GTAGAACTTGGGCCAGCCAGAGATACTGTAATTTCTCAACTTAATGAGCAAGATAGGGGT
GTAAAGCAGGAGCCAGCTGGTGACACTGCAGTGCCACAACCTGACGTGGACGCTAGGGTC
GTAAAGGAGGAGTCACCAAGAACGGAACCTAATGGGGAAGCTACGAACATGAAGGAGACA
CCAAAGAACTCTGCAGTGTGTAATTCTCCAGAGACAAAGGAATTTGGAGATATTACAGCA
ATGGGTTCAGATCCTCCCGCAACTAATATGAGCGAAGAATAA

Protein

474 aa

>Os11t0109900-01 Double-stranded RNA-binding-like domain containing protein.
MDMPPTPLPPETANTSPAPNGATAGIRVENCYVFKSRLQEYAQKAGLQTPEYHTFKEGPS
HEPVFKSTVVINNTSYDSLPGFFNRKAAEQSAAEVALMEIVKSIPANANIPAVQETGLCK
NLLQEYAQKMNYAIPSYICTKSASGLAPFICTVEIGGIQYIGAAARTKKDAEIKAARTAL
LAIQGQSEGSANGATKYIVVPGKRVGKEVEKMPIETPKPLKIKKGGFKKKWNKRKFMKKD
GQAVVEKDEARVAGDAHDSDVLMQPTVITQEASCGTLFLQPCEEAKRVEAEPPRDIEMVQ
PDKENQHSDAALVQPDDEARVEQEPSRDISVVPPNEEAISVKQEPSIDAAILQPKEEASS
VKQEPFIDTAMLQACKEAGSVELGPARDTVISQLNEQDRGVKQEPAGDTAVPQPDVDARV
VKEESPRTEPNGEATNMKETPKNSAVCNSPETKEFGDITAMGSDPPATNMSEE*

5'UTR

chr11:461596..461678 (- strand) : 83 bp

CDS

chr11:461517..461595 (- strand) : 79 bp

chr11:460922..461181 (- strand) : 260 bp

chr11:458532..458745 (- strand) : 214 bp

chr11:457519..458387 (- strand) : 869 bp

3'UTR

chr11:457195..457518 (- strand) : 324 bp

FASTA

>Os11t0109900-01 class=Sequence position=chr11:457195..461678 (- strand)
ATCGCACCAC GCACACAACC AAAACCCTTC TCTTCTCTCT CGACTCTCGA CGACGCTGCG GCGGCGGTGG CGGCGAGGTG
GGAATGGACA TGCCGCCCAC GCCCCTTCCG CCGGAGACCG CCAACACCTC GCCCGCTCCC AACGGCGCCA CCGCCGGAAT
CAGTATGTTT CTCTCTCTCC CCCCTCCCTC TCAACACTCT TCTTTGGTCT CAACAAGAAC CAAGGGAGGA CTGTTCATTC
CAACGAGCTA ACCGCAGGTT TTGGTTCCTC TCCACTTTTT AAATGGAAAT TGCTTTACTG GAGAGCATTC ACCATCATAC
ATGATGCATT GATGCGCCTG GGATGTAACT ACTACTACAT TTGTTGCCGA AACATTACTT GCATTATTAT GTCATCTTGA
TAGAGAGCTG GTTGCTGGGA CGAAATCTCA AAAATTGCTC TTCCCGGCAT CGTGGTAATG CTATTTTCTG AGTTGTGGTA
TGCTTGATTT GGCCCAGGGG TTGAGAACTG CTACGTCTTC AAGAGCCGGC TGCAAGAGTA TGCGCAGAAA GCCGGCCTCC
AGACTCCAGA GTATCATACC TTCAAGGAGG GACCTTCCCA TGAGCCTGTC TTCAAGTCCA CAGTGGTGAT TAATAACACC
AGCTATGACT CCCTGCCCGG ATTCTTCAAC AGAAAGGCTG CAGAACAGTC TGCTGCTGAA GTTGCCCTCA TGGAAATTGT
CAAGTCCATA CCAGCCAACG CAAACATCCC AGCTGTTGTA AGTCACTGTC TGCTCTACTT GTGTTTTTGT TTAACTCAAC
ATGATGGAAT ACCTGGGGCC TGGGAGGACC TGCTGGTGTA GTACAAGATT AGTAAAAGTG TTGGGATAGT CTACTTATTT
CTATACAGTG CCTGCTTTTG AATTCGCGCG AATCCGAAGA ATGAGATAGC CACTCACCTG ATAACTCCAG AACGAATCAG
GGCTTTCATG TTTGGATAGA GTTAGGTCCT AGAGAGCAAG AAGAGAGGGT ATTTGCATAG AAGAGATTGT GAAAGCTTTG
CTGTCAGTCA CCACGGTCTT ATTATTATCT GCCGTCATGA TCTGTCTGTA TCTTTTCAGG CTCATAATTC TACTCAGGTA
TTATATGAAT ATAACAGGAA ATTGGTTGTT AAAGAGCTTC TGAACTCACT CTTCCCCGGT TTGTGAACCA TGAACAATGC
AAACATCAAA GTACACATAT TAAGTTTTGT GATCATTTCC GAGTCCAAGA CCTAGATAAT TTTGATGCTC TTTTGGTCGA
GTCCCTAGGA ATTAACGCCT GACTAAATTA GCATAGTGCT ATAATCTCTT ACCTGGATTC TATGTTCTTG ACACACCTTA
ATATGTTTTC CAGCAAGAGA CTGGCCTGTG CAACACAGGA AGTCAGCAAC TGAACCTGAG GGAAATGCAC CGAGAAGCTG
ACCACCACCA CCGCCTTCTG GCAACCCTTG CACGCCACTG CCGTCTTGCT GCCGCTGCCA CCTTCTTCTC CTCCACCCTC
CGCACTGCTC GTGCCCTCAA CTCCCTCCTC GCTGCTATCT GCTCTTCCCC AGCGTTCCTC CGCTTTGCCC CTAAAGTCCT
CTTGCTCGCT GCCCCATCAG TCTCCCCTGA TGCGACCACC TTCCACATCC TCATCTCCAC ACTCTGCCAG GCCCACCGCC
CCGCTGCTGC CGCCGACCTC CTTTGCTGCA TGCCCTCGCT TCTTCTTGAC CCTGACCTGG CCAGTTGTCG TGCTGTCCTC
TCCTCCCTGT GCCAGTACGC TTCCGCTCAG GATGCAGTAG CATTCTTGGA CAAGATGTGC CATTGGGGCA TTTCCCCAAG
CAGATCTGAC TACCACGCCG TCTTCGATGC GCTTCTGCAG GAGGGAAAGG TAGCGGAGGC ATATGAGGTC ATGAAGAATA
AGATGGGCTC TAACAGGGTG GCACCTGCAC TTGCATACTT CAAATTGACA ATGCAAGCTT TCAGCGAGTG CTTGGAGTTC
GATTCTGTGG AGGAGGTGTT TGATGAAATG CTCCTGAGAG GGCTGGTACC AGACGTGGAT GTGTATAGTG TGTACATCAG
CGCGCTATGT AGGAAAGGTG ACCTTGCCGG AGCGCGGCAG ATGATGACCT GCATGGAGCA CGCCGGGTGC CCACCGGATG
TAAGGACATT TGGTGTGGTA GTCGCCGGGT GCATGTCTGC CGGGGACATG GGCACAGTGA GGGAGTTGGT GCAGGAGGCA
ATAAGGCGTG GCCTGCAGTG GGATCCACCA GCATTGTCGG AGCTGATAGG CTTGCTGCAG GCAGGTGATG GTGCCACACA
GTCACAGGAG TTACTGTTGG AGCCACTATT TGTGCACGAT GCACCAGTGT TGGGGCAGCT GATTGGAGCA TTGTGCAAGC
AAGGGCTATT GGGACCTGCT GCTGTAGTAG ATGATTATTA GAAAGCATTG TAATTGTCTT TTTGTTTCAA ACTTTCAATA
CAGTTGTTGG TTTTGAATTC TCAGAAATCT GAAGAACGGC ATAAGAATTA TAAAAACAGA GACAGAAAAG GCAAACCATG
GACTATAACT CCAGGAATAC TCAGAGCTTT CGGCTTTGTA GATCACTAGA TTGTCGGCTA AAGTTAGGAC CCAGTGAGCA
AGAAGGGAGG GTATTTGTAT AGATCGGCCA GGTAGGAGAT TGCAGAAAGT CTTTATTGTT GTCTTCTGTC ATGATTTATT
TGTATTTTCT CAAGCTTACA ACTCTACTAG GTTATTCCCA TGAATACAAT AGGAAATTAG TCGTTTAATA GCTACTGAAC
TCGTACTGCC AGGATTTAGA TAATTTGGAT GTTCTTTAGT TCTTAGGAAT CAGGCTGACT AAACTTAGCA TAGTGTTATA
ATCTCTTTCC TGGATCACTG TGCATTTTTT TACACATATT AATATGTTTT CAGCAAGAGA CTGGGCTGTG CAAGAATCTT
CTTCAGGAGT ATGCACAGAA GATGAATTAT GCCATTCCAT CTTATATTTG CACCAAATCA GCCTCAGGCT TAGCTCCTTT
CATATGCACT GTAGAGATTG GTGGAATACA ATATATTGGT GCTGCAGCCA GAACAAAGAA AGATGCAGAG ATAAAAGCTG
CTCGAACTGC TCTTCTGGCA ATTCAAGGTA TTGTTCTGTT CTTCTCTAAG GGTCTTATTT TTATTTTTTA TATTATCCAG
GCTATTCACT GTTAAAATTA ACATTGCTAT GTTCTTGTTT GTGTGTTATT ATGGTGAACA TTGGGTCATG CATGGGCATT
GCTTGGTGCA GGTCAATCAG AGGGTTCTGC AAATGGTGCG ACAAAATATA TTGTAGTTCC TGGTAAAAGG GTAGGTAAGG
AGGTAGAGAA AATGCCAATT GAAACCCCCA AACCACTTAA AATAAAGAAA GGTGGTTTCA AGAAGAAATG GAACAAGAGG
AAATTCATGA AGAAGGATGG TCAAGCTGTT GTGGAAAAGG ATGAAGCTAG AGTGGCTGGA GATGCTCACG ATTCTGACGT
CCTAATGCAG CCAACAGTAA TAACACAGGA GGCATCTTGT GGCACTCTGT TCCTTCAACC TTGTGAGGAA GCTAAAAGAG
TAGAAGCTGA GCCACCTAGA GATATTGAAA TGGTACAACC TGATAAGGAG AACCAACACA GTGACGCTGC ATTGGTGCAA
CCTGATGATG AAGCTAGAGT AGAACAGGAG CCATCCAGAG ATATTTCAGT GGTGCCACCT AATGAGGAAG CTATAAGTGT
TAAGCAGGAA CCATCCATCG ATGCTGCAAT TCTGCAACCT AAAGAGGAAG CTTCAAGTGT AAAGCAGGAG CCATTCATCG
ATACTGCAAT GCTGCAAGCT TGTAAGGAAG CTGGAAGTGT AGAACTTGGG CCAGCCAGAG ATACTGTAAT TTCTCAACTT
AATGAGCAAG ATAGGGGTGT AAAGCAGGAG CCAGCTGGTG ACACTGCAGT GCCACAACCT GACGTGGACG CTAGGGTCGT
AAAGGAGGAG TCACCAAGAA CGGAACCTAA TGGGGAAGCT ACGAACATGA AGGAGACACC AAAGAACTCT GCAGTGTGTA
ATTCTCCAGA GACAAAGGAA TTTGGAGATA TTACAGCAAT GGGTTCAGAT CCTCCCGCAA CTAATATGAG CGAAGAATAA
GCTGTGGTTG TTGAATCAAA ATGCAATAGC TTTAGTGTGT TCACCTGCAG AGGGCGAAGA ATAAGCTGCG GTTGTTGAAT
CAAAATGCAA TAGCCTTAGT GTGTTCACCT GCAGAGGTGT GAAACATGAA TGGCTGGCTT TTCCAGTTTA AAAAGAGGCA
GCTGGAATAG GAAGATGTAT GTGGGCTGAG AATAGTTAGT TCATATTTGT CATTGTTAGC TAGGCATGTG TATGCCTGAT
GATATGAATG AAATGTATTA CCTGCTGCTT TAGTGAGCAC TACTTTGAAA AGAAGGGGAA AAAATGAATT CGAGGTTTCT
GATC