Os11t0114900-01

Locus

Os11g0114900

Description

Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.8, OsLtpI.8

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.8, lipid transfer protein 1.8, type 1 non-specific lipid transfer protein 8, Phospholipid transfer protein 9C2

Transcript Evidence

AK063683 (DDBJ, Best hit)

Protein Evidence

A3C7Z0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

001-119-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0114900-01)

RiceXPro (AK063683)

Others

Oryzabase (13517)

KEGG (Os11t0114900-01)

Transcript

745 bp

>Os11t0114900-01 Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).
ACTCACCCACACCACACTCCACTCCACTCCACTACTGCGCTTAGCTAATTAAGCAGCAAC
TTAACTTGATCTTCTTGTGACCGATCGATGGCTCGCCCGGCGAATAATAACTATGCGGCG
GCGGTGATGGTGGTGGCGCTGCTGGTGGCGGCGCCGGCGGCGAGCGCGGTGACATGCGGG
CAGGTGGTGAGCATGCTGGCACCGTGCATCATGTACGCGACGGGGAGGGTGTCCGCCCCC
ACCGGCGGctgctgcgacggggtcaggaccctcaactccgccgccgccaccaccgccgac
cgccagaccacctgcgcctgcctcaagcagcagaccagcgccatgggcggcctgaggccc
gacctcgtcgccggcaTCCCCTCCAAGTGCGACGTCAACATCCCCTACGCCATCAGCCCT
TCCACCGACTGCTCCAGGGTGCACTGATGAGCGGATCAACGTCGACAAGTGATGCGACAA
TAATAAAGGAGAGATCGATCCATCGATCTCCAGCTCTCATTTCGCGGTTGCTATGTGCAT
GCGCCGTCGTCAATGATCGAGCTAGAAATATATATGCATGTTGCTCCTTCGTTGTGTTAC
TTCCTGCTTACCTGCTGCGGTTTGATAGTTAGCTAGTGTGAGAGACTGTGAGGGTTGATT
TTGGGGCAGACGAATCATGAATCTCAGAGGACCTTGTACCACTGCACGCTTCAATATATA
TCCATCAAATGCAGGGTCTTTTAAT

CDS

360 bp

>Os11t0114900-01 Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).
ATGGCTCGCCCGGCGAATAATAACTATGCGGCGGCGGTGATGGTGGTGGCGCTGCTGGTG
GCGGCGCCGGCGGCGAGCGCGGTGACATGCGGGCAGGTGGTGAGCATGCTGGCACCGTGC
ATCATGTACGCGACGGGGAGGGTGTCCGCCCCCACCGGCGGctgctgcgacggggtcagg
accctcaactccgccgccgccaccaccgccgaccgccagaccacctgcgcctgcctcaag
cagcagaccagcgccatgggcggcctgaggcccgacctcgtcgccggcaTCCCCTCCAAG
TGCGACGTCAACATCCCCTACGCCATCAGCCCTTCCACCGACTGCTCCAGGGTGCACTGA

Protein

120 aa

>Os11t0114900-01 Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).
MARPANNNYAAAVMVVALLVAAPAASAVTCGQVVSMLAPCIMYATGRVSAPTGGCCDGVR
TLNSAAATTADRQTTCACLKQQTSAMGGLRPDLVAGIPSKCDVNIPYAISPSTDCSRVH*

5'UTR

chr11:680034..680120 (+ strand) : 87 bp

CDS

chr11:680121..680470 (+ strand) : 350 bp

chr11:680577..680586 (+ strand) : 10 bp

3'UTR

chr11:680587..680884 (+ strand) : 298 bp

FASTA

>Os11t0114900-01 class=Sequence position=chr11:680034..680884 (+ strand)
ACTCACCCAC ACCACACTCC ACTCCACTCC ACTACTGCGC TTAGCTAATT AAGCAGCAAC TTAACTTGAT CTTCTTGTGA
CCGATCGATG GCTCGCCCGG CGAATAATAA CTATGCGGCG GCGGTGATGG TGGTGGCGCT GCTGGTGGCG GCGCCGGCGG
CGAGCGCGGT GACATGCGGG CAGGTGGTGA GCATGCTGGC ACCGTGCATC ATGTACGCGA CGGGGAGGGT GTCCGCCCCC
ACCGGCGGct gctgcgacgg ggtcaggacc ctcaactccg ccgccgccac caccgccgac cgccagacca cctgcgcctg
cctcaagcag cagaccagcg ccatgggcgg cctgaggccc gacctcgtcg ccggcaTCCC CTCCAAGTGC GACGTCAACA
TCCCCTACGC CATCAGCCCT TCCACCGACT GCTCCAGGTA ATTCATTTGC CATCAATAAC GGTTTTGATC TGTACGTTAT
TAGCTGCAGC TTAATTAACC ATTGTTAATC TGCCTATGTA TTTGTGCGTT AATTCGCACG CAGGGTGCAC TGATGAGCGG
ATCAACGTCG ACAAGTGATG CGACAATAAT AAAGGAGAGA TCGATCCATC GATCTCCAGC TCTCATTTCG CGGTTGCTAT
GTGCATGCGC CGTCGTCAAT GATCGAGCTA GAAATATATA TGCATGTTGC TCCTTCGTTG TGTTACTTCC TGCTTACCTG
CTGCGGTTTG ATAGTTAGCT AGTGTGAGAG ACTGTGAGGG TTGATTTTGG GGCAGACGAA TCATGAATCT CAGAGGACCT
TGTACCACTG CACGCTTCAA TATATATCCA TCAAATGCAG GGTCTTTTAA T

Locus: Os11g0114900

Loading...

Locus: Os11g0114900

Loading...