Os11t0115100-01

Locus

Os11g0115100

Description

Similar to Lipid transfer protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.9, OsLtpI.9

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.9, lipid transfer protein 1.9, type 1 non-specific lipid transfer protein 9

Transcript Evidence

AK119692 (DDBJ, Best hit)

AK119677 (DDBJ, Best hit)

Protein Evidence

B7E4W9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

002-157-B12 (Online Clone Ordering)

002-156-H07 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0115100-01)

Others

Oryzabase (13518)

Transcript

685 bp

>Os11t0115100-01 Similar to Lipid transfer protein.
ACTCCAGTACTCCACCACAAGCTCTAGCTTACAGCTCACTACCAGTGTACATTGTTGCTA
GTTAGCTAGAGCTAGATCTCGATCGAGACAATGGCGGGTGCTCGCAGGACGATGGCGCTG
GTTGCGTTGGTGGCGGTGGTGGCGGCGGCGGTGGTGGCGGAGAGGGCGTCGGCGGCGGTG
AGCTGCGGCGACGTGACGTCGTCGATCGCGCCGTGCCTGTCGTACGTGATGGGGAGGGAG
AGCTCGCCGTCGTCGTCGTGCTGCAGCGGGGTGAGGACCCTCAACGGCAAGGCCTCGTCG
TCGGCCGACCGCCGCACCGCCTGCAGCTGCCTCAAGAACATGGCCTCCTCCTTCAGGAAC
CTCAACATGGGCAACGCCGCCTCCATCCCCAGCAAATGCGGCGTCTCCGTCGCCTTCCCC
ATCAGCACCTCCGTCGACTGCTCCAAGATCAACTAATTACTAGCTTGATCATCTCCAGCT
GAGATCGATATGTATGGGAAGATCTAGAGAGTGACTGTTCACTGCTAGCTTTGTTTATTT
TCTTGCTGCATGCGTACGTGCACTATATAATGTAATAATGCGTTTCAATGTTTACATGTA
GTGTACTATGTACACTACTTATATATTTTTCATATATAATAATCTAATAATGATAATAAT
GTCGTACTGATACATGCGTACACAC

CDS

366 bp

>Os11t0115100-01 Similar to Lipid transfer protein.
ATGGCGGGTGCTCGCAGGACGATGGCGCTGGTTGCGTTGGTGGCGGTGGTGGCGGCGGCG
GTGGTGGCGGAGAGGGCGTCGGCGGCGGTGAGCTGCGGCGACGTGACGTCGTCGATCGCG
CCGTGCCTGTCGTACGTGATGGGGAGGGAGAGCTCGCCGTCGTCGTCGTGCTGCAGCGGG
GTGAGGACCCTCAACGGCAAGGCCTCGTCGTCGGCCGACCGCCGCACCGCCTGCAGCTGC
CTCAAGAACATGGCCTCCTCCTTCAGGAACCTCAACATGGGCAACGCCGCCTCCATCCCC
AGCAAATGCGGCGTCTCCGTCGCCTTCCCCATCAGCACCTCCGTCGACTGCTCCAAGATC
AACTAA

Protein

122 aa

>Os11t0115100-01 Similar to Lipid transfer protein.
MAGARRTMALVALVAVVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSG
VRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI
N*

5'UTR

chr11:684777..684866 (+ strand) : 90 bp

CDS

chr11:684867..685222 (+ strand) : 356 bp

chr11:685313..685322 (+ strand) : 10 bp

3'UTR

chr11:685323..685551 (+ strand) : 229 bp

FASTA

>Os11t0115100-01 class=Sequence position=chr11:684777..685551 (+ strand)
ACTCCAGTAC TCCACCACAA GCTCTAGCTT ACAGCTCACT ACCAGTGTAC ATTGTTGCTA GTTAGCTAGA GCTAGATCTC
GATCGAGACA ATGGCGGGTG CTCGCAGGAC GATGGCGCTG GTTGCGTTGG TGGCGGTGGT GGCGGCGGCG GTGGTGGCGG
AGAGGGCGTC GGCGGCGGTG AGCTGCGGCG ACGTGACGTC GTCGATCGCG CCGTGCCTGT CGTACGTGAT GGGGAGGGAG
AGCTCGCCGT CGTCGTCGTG CTGCAGCGGG GTGAGGACCC TCAACGGCAA GGCCTCGTCG TCGGCCGACC GCCGCACCGC
CTGCAGCTGC CTCAAGAACA TGGCCTCCTC CTTCAGGAAC CTCAACATGG GCAACGCCGC CTCCATCCCC AGCAAATGCG
GCGTCTCCGT CGCCTTCCCC ATCAGCACCT CCGTCGACTG CTCCAAGTAT TCTACATTTT CTCTCTCTCT ATCTTCATTT
GCTCCATCCA TGTGTTGGCC TAATTAAGCT AATTTCCTCT TTCCTTTTTT ATGCAGGATC AACTAATTAC TAGCTTGATC
ATCTCCAGCT GAGATCGATA TGTATGGGAA GATCTAGAGA GTGACTGTTC ACTGCTAGCT TTGTTTATTT TCTTGCTGCA
TGCGTACGTG CACTATATAA TGTAATAATG CGTTTCAATG TTTACATGTA GTGTACTATG TACACTACTT ATATATTTTT
CATATATAAT AATCTAATAA TGATAATAAT GTCGTACTGA TACATGCGTA CACAC

Locus: Os11g0115100

Loading...

Locus: Os11g0115100

Loading...