Os11t0116000-01

Locus

Os11g0116000

Description

Similar to Nonspecific lipid-transfer protein 1 (LTP 1) (Major allergen Pru d 3).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.12, OsLtpI.12

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.12, lipid transfer protein 1.12, type 1 non-specific lipid transfer protein 12

Transcript Evidence

AK061182 (DDBJ, Best hit)

AK059714 (DDBJ, Best hit)

AK073363 (DDBJ, Best hit)

Protein Evidence

A2ZAT2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

006-209-D09 (Online Clone Ordering)

001-032-F09 (Online Clone Ordering)

J033030A16 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0116000-01)

Others

Oryzabase (13521)

Transcript

928 bp

>Os11t0116000-01 Similar to Nonspecific lipid-transfer protein 1 (LTP 1) (Major allergen Pru d 3).
ATCGATCACCGGCGACGAGAGACACTCTCACTGAACGAAGCTACCTAGCTTAATTACCTA
GCTACTCGATCGATCATCAGTCTAGATATGGCGGCTTTGAACGGTAAGGTGGTGGTGGCG
GTGATGGTGGTGGCGATGGTGGTGGCGGCGCCGGGGGCGTCGGCGGCGATCACGTGCGGG
CAGGTGGGGTCGGCGATCGCGCCGTGCATCTCGTACGTGACGGGGAGGGGCGGCCTCACC
CAGGGATGCTGCAACGGCGTCAAGGGGCTGAACAACGCCGCCCGCACCACCGCCGACCGC
CAGGCCGCCTGCCGGTGCCTCAAGACCCTCGCCGGCACCATCAAGTCTCTCAACCTCGGC
GCCGCCGCCGGCATCCCCGGCAAGTGCGGCGTCAACGTCGGCTTCCCCATCAGCCTCTCC
ACTGACTGCAGCAAGGTCAGCTAGATCGATTAATCCTGCTTGGACCGACCGATCGATATA
TCGATCGATGCTGGCTCGCAGTTGATCAACTAGCCAAAATAATAGCTACAGTAAAAATAA
CAGCTGGGGCATATCAATGCAGCGCTGGTCATCTCTCTCTCTATCTCTGTATACTTTATG
TTGCACGCTCCGTGCGTGCATGCTATCTTAATTTTCTTGACTCTGTACACCGCTCTGTGT
ACGTGTAATCCTACGTTGATGAATTGCATCTTGTCCAGACTTGGACCTAGCTAACTACGT
ACTCCAGCTTGGCAGCTTCTTGCCGAGGCAATCTGTAGTAATTTCCTTGTTACATTCCCC
TGTCCCCTCtactccctctatcccataaaaacaaacctaatatactaaatatgacacata
tattctagtactacaaatctagacagatgtatatttagatttgttatactagaatatgtc
acatccagtcttatgttcgtttttttgg

CDS

357 bp

>Os11t0116000-01 Similar to Nonspecific lipid-transfer protein 1 (LTP 1) (Major allergen Pru d 3).
ATGGCGGCTTTGAACGGTAAGGTGGTGGTGGCGGTGATGGTGGTGGCGATGGTGGTGGCG
GCGCCGGGGGCGTCGGCGGCGATCACGTGCGGGCAGGTGGGGTCGGCGATCGCGCCGTGC
ATCTCGTACGTGACGGGGAGGGGCGGCCTCACCCAGGGATGCTGCAACGGCGTCAAGGGG
CTGAACAACGCCGCCCGCACCACCGCCGACCGCCAGGCCGCCTGCCGGTGCCTCAAGACC
CTCGCCGGCACCATCAAGTCTCTCAACCTCGGCGCCGCCGCCGGCATCCCCGGCAAGTGC
GGCGTCAACGTCGGCTTCCCCATCAGCCTCTCCACTGACTGCAGCAAGGTCAGCTAG

Protein

119 aa

>Os11t0116000-01 Similar to Nonspecific lipid-transfer protein 1 (LTP 1) (Major allergen Pru d 3).
MAALNGKVVVAVMVVAMVVAAPGASAAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKG
LNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKVS*

5'UTR

chr11:715445..715531 (+ strand) : 87 bp

CDS

chr11:715532..715878 (+ strand) : 347 bp

chr11:715985..715994 (+ strand) : 10 bp

3'UTR

chr11:715995..716478 (+ strand) : 484 bp

FASTA

>Os11t0116000-01 class=Sequence position=chr11:715445..716478 (+ strand)
ATCGATCACC GGCGACGAGA GACACTCTCA CTGAACGAAG CTACCTAGCT TAATTACCTA GCTACTCGAT CGATCATCAG
TCTAGATATG GCGGCTTTGA ACGGTAAGGT GGTGGTGGCG GTGATGGTGG TGGCGATGGT GGTGGCGGCG CCGGGGGCGT
CGGCGGCGAT CACGTGCGGG CAGGTGGGGT CGGCGATCGC GCCGTGCATC TCGTACGTGA CGGGGAGGGG CGGCCTCACC
CAGGGATGCT GCAACGGCGT CAAGGGGCTG AACAACGCCG CCCGCACCAC CGCCGACCGC CAGGCCGCCT GCCGGTGCCT
CAAGACCCTC GCCGGCACCA TCAAGTCTCT CAACCTCGGC GCCGCCGCCG GCATCCCCGG CAAGTGCGGC GTCAACGTCG
GCTTCCCCAT CAGCCTCTCC ACTGACTGCA GCAAGTAAAT TAATCATCCA TGCATATGCA TGCTACTTTT TTTCAAGTTA
ATTCAACTTA ATTTACTGAC TAATCCACTG TATATATGCA TGATTATTTC ATTGGTGCAG GGTCAGCTAG ATCGATTAAT
CCTGCTTGGA CCGACCGATC GATATATCGA TCGATGCTGG CTCGCAGTTG ATCAACTAGC CAAAATAATA GCTACAGTAA
AAATAACAGC TGGGGCATAT CAATGCAGCG CTGGTCATCT CTCTCTCTAT CTCTGTATAC TTTATGTTGC ACGCTCCGTG
CGTGCATGCT ATCTTAATTT TCTTGACTCT GTACACCGCT CTGTGTACGT GTAATCCTAC GTTGATGAAT TGCATCTTGT
CCAGACTTGG ACCTAGCTAA CTACGTACTC CAGCTTGGCA GCTTCTTGCC GAGGCAATCT GTAGTAATTT CCTTGTTACA
TTCCCCTGTC CCCTCtactc cctctatccc ataaaaacaa acctaatata ctaaatatga cacatatatt ctagtactac
aaatctagac agatgtatat ttagatttgt tatactagaa tatgtcacat ccagtcttat gttcgttttt ttgg

Locus: Os11g0116000

Loading...

Locus: Os11g0116000

Loading...