Os11t0116200-01

Locus

Os11g0116200

Description

Similar to nonspecific lipid-transfer protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.13, OsLtpI.13

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.13, lipid transfer protein 1.13, type 1 non-specific lipid transfer protein 13

Transcript Evidence

AK064888 (DDBJ, Best hit)

Protein Evidence

Q2QYK8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J013000K13 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0116200-01)

RiceXPro (AK064888)

Others

Oryzabase (13522)

KEGG (Os11t0116200-01)

Transcript

736 bp

>Os11t0116200-01 Similar to nonspecific lipid-transfer protein 3.
GCCCAGCATCTTCCTATTTATACCCTCCACCCATCGACCGACGATCCATCACCGGCGACG
AGGAGACACTCACTGATATAATCAAGCTAGCTAGCTTAATCACCTAGCTATCCGTCAGTT
TAGCTAGATATGGCTGCAGTTAACTGCAAGGTGGTGGTCGCCGTGATTGTGGTGGCGATG
GTGGTTGCGGCGCCGGGGGCGTCGGCGGCGATAACGTGCGGGCAGGTGGGATCGGCGATC
GCGCCGTGCATCTCGTACGTGACGGGGAGGAGCGGCCTCACGCAGGGATGCTGCAACGGA
GTGAAGGGGCTGAACAACGCCGCCCGCACCACCGCCGACCGCCAGGCGGCCTGCCGCTGC
CTCAAGAGCCTCGCCGGCAGCATCAAGTCGCTCAACCTCGGCACCGTCGCCGGCGTCCCC
GGCAAGTGCGGCGTCAACGTCGGCTTCCCCATCAGCCTCTCCACCGACTGCAACAAGGTC
AGCTAGATCAATTAATCCTGCTTGGATCGATCGATCGAGCTTAACACGCTAGCTCGATCG
GAGTTGATCAGCTAGTAATTAAGCACGTATTTGCTACAGCATATATGAACAAAGTAATTA
AAATAACACCTGCGGCAGACATGCAGCGCTCCATTCTCTCTCTGTATCAGCTGTATACTT
TATGTTGCACGCTCCCTGTGTGCATGTTCTATCTTAATTTTCTTCAGTATGTACACGATC
TGTGTGTACTACGTGT

CDS

357 bp

>Os11t0116200-01 Similar to nonspecific lipid-transfer protein 3.
ATGGCTGCAGTTAACTGCAAGGTGGTGGTCGCCGTGATTGTGGTGGCGATGGTGGTTGCG
GCGCCGGGGGCGTCGGCGGCGATAACGTGCGGGCAGGTGGGATCGGCGATCGCGCCGTGC
ATCTCGTACGTGACGGGGAGGAGCGGCCTCACGCAGGGATGCTGCAACGGAGTGAAGGGG
CTGAACAACGCCGCCCGCACCACCGCCGACCGCCAGGCGGCCTGCCGCTGCCTCAAGAGC
CTCGCCGGCAGCATCAAGTCGCTCAACCTCGGCACCGTCGCCGGCGTCCCCGGCAAGTGC
GGCGTCAACGTCGGCTTCCCCATCAGCCTCTCCACCGACTGCAACAAGGTCAGCTAG

Protein

119 aa

>Os11t0116200-01 Similar to nonspecific lipid-transfer protein 3.
MAAVNCKVVVAVIVVAMVVAAPGASAAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKG
LNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNKVS*

5'UTR

chr11:722933..723061 (+ strand) : 129 bp

CDS

chr11:723062..723408 (+ strand) : 347 bp

chr11:724118..724127 (+ strand) : 10 bp

3'UTR

chr11:724128..724377 (+ strand) : 250 bp

FASTA

>Os11t0116200-01 class=Sequence position=chr11:722933..724377 (+ strand)
GCCCAGCATC TTCCTATTTA TACCCTCCAC CCATCGACCG ACGATCCATC ACCGGCGACG AGGAGACACT CACTGATATA
ATCAAGCTAG CTAGCTTAAT CACCTAGCTA TCCGTCAGTT TAGCTAGATA TGGCTGCAGT TAACTGCAAG GTGGTGGTCG
CCGTGATTGT GGTGGCGATG GTGGTTGCGG CGCCGGGGGC GTCGGCGGCG ATAACGTGCG GGCAGGTGGG ATCGGCGATC
GCGCCGTGCA TCTCGTACGT GACGGGGAGG AGCGGCCTCA CGCAGGGATG CTGCAACGGA GTGAAGGGGC TGAACAACGC
CGCCCGCACC ACCGCCGACC GCCAGGCGGC CTGCCGCTGC CTCAAGAGCC TCGCCGGCAG CATCAAGTCG CTCAACCTCG
GCACCGTCGC CGGCGTCCCC GGCAAGTGCG GCGTCAACGT CGGCTTCCCC ATCAGCCTCT CCACCGACTG CAACAAGTAT
ATCATCTCTC TATGACTCCT CTCTCTCTCT CTATATATAT ATATACACGc atatatctct ttatttttta cgtgctatct
aaatactccc tccgtttcag gttataagac gttttaactt tggttaaagt taaacttctc taagtttaac taattctgta
gaaaaaagta ataatattta aataccatca tagtttcatt aaatccataa ttgaataaat tttcataata tatttgtcat
gggttaaaaa agatactact tttttactac aaaatcagta aaacttacag tattttaact ttaaccaaag tcaaaacgtc
ttataatcta aaatggagca atagttaata aaaactTTTA CAAGTTaaga tagattacca tatgtgagat atatctcact
tcatagacat aaaagattaa attcaactta tacaagttaa attaaaaaac aaactaaact aacactagtt aacgtatttt
cgctattata tctgttatta ttgttacaac ttgtacaagt ttaatttaaa catgtatatt tatggacatg catatttaat
attaatctat cttatcattt tgttttactt tttaatggct attaaggtgg ggggatgaaa gcaacaatga gatatttctc
gagatatgaa acattttccc ataaAATAAC TACCTATATA TATGCATTTT TTTTCTTTGG TGCAGGGTCA GCTAGATCAA
TTAATCCTGC TTGGATCGAT CGATCGAGCT TAACACGCTA GCTCGATCGG AGTTGATCAG CTAGTAATTA AGCACGTATT
TGCTACAGCA TATATGAACA AAGTAATTAA AATAACACCT GCGGCAGACA TGCAGCGCTC CATTCTCTCT CTGTATCAGC
TGTATACTTT ATGTTGCACG CTCCCTGTGT GCATGTTCTA TCTTAATTTT CTTCAGTATG TACACGATCT GTGTGTACTA
CGTGT

Locus: Os11g0116200

Loading...

Locus: Os11g0116200

Loading...