Os11t0116200-02

Locus

Os11g0116200

Description

Similar to Zinc finger, C3HC4 type family protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.13, OsLtpI.13

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.13, lipid transfer protein 1.13, type 1 non-specific lipid transfer protein 13

Transcript Evidence

AK060108 (DDBJ, Best hit)

Protein Evidence

Q2QYK7 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-H2-type (IPR024766)

Full-length cDNA

006-308-C09 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0116200-02)

Others

Oryzabase (13522)

Transcript

1196 bp

>Os11t0116200-02 Similar to Zinc finger, C3HC4 type family protein, expressed.
ATCACCGGCGACGAGGAGACACTCACTGATATAATCAAGCTAGCTAGCTTAATCACCTAG
CTATCCGTCAGTTTAGCTAGATATGGCTGCAGTTAACTGCAAGGTGGTGGTCGCCGTGAT
TGTGGTGGCGATGGTGGTTGCGGCGCCGGGGGCGTCGGCGGCGATAACGTGCGGGCAGGT
GGGATCGGCGATCGCGCCGTGCATCTCGTACGTGACGGGGAGGAGCGGCCTCACGCAGGG
ATGCTGCAACGGAGTGAAGGGGCTGAACAACGCCGCCCGCACCACCGCCGACCGCCAGGC
GGCCTGCCGCTGCCTCAAGAGCCTCGCCGGCAGCATCAAGTCGCTCAACCTCGGCACCGT
CGCCGGCGTCCCCGGCAAGTGCGGCGTCAACGTCGGCTTCCCCATCAGCCTCTCCACCGA
CTGCAACAACCAGCCATGCGGCGGCTGGGTGACGTCGTGGAGGCGCCTGCGCTGGTGCTG
ACGCCGGCCTCCATGCAGCAGGCCGGCGGGAGGGGGAGCTCCGGCGCCTTGGACGCCAGC
ATGGTCGTCATCCTCGCCGCGCTGCTCTGCGTCGTCATCTGCGCCCTCGGCCTCACCTCC
CTCATCCGCTGCGCGCTCCACTGCGCCCGCGGCCTCTCCCCCACCACGGCGACGCCGACG
CCGTCGGTGTCGACAGCTGCCACGGCCGGGCTGAAGAAGACGGAGCTGAGGAGGATTCCG
GTGGAGGTGTACGGCGCCAAGCAGGCCGGCGTCCCCGACGGCGAGTGCGCCATCTGCCTG
GGCGACTTCGCCGACGGCGACAAGGTGCGCGTGCTCCCGAGGTGCCACCACGGCTTCCAC
GTCCGCTGCATCGACACGTGGCTCGCCGCGCACACGTCCTGCCCTACTTGCCGGGACTCC
ATTCTCTCCGTCCATGGAGTCGTCGCCGGCGGCCAAACATAGCTAGTAATATAATTTCTT
GAACAGAAGAGGTCTAAAATGTAAATAGAATATAGGTGGTAAAGTACTCCAAAATTGGGA
TTGCGTAAATGCAAGGGATTGGACACAATGTTTGAAGTGTCTCTGTCACTTGGATTATCC
ATCTGTTTAGCTGTTTCTATGAGTTTTCTCCTTTAATTTGTGTGCTAGCACATGATATTT
CCCCCAAGATTCGCTGTTCGTTTGTTCTGGGCATAATTTTGTCACCACTCAACAAC

CDS

702 bp

>Os11t0116200-02 Similar to Zinc finger, C3HC4 type family protein, expressed.
ATGCTGCAACGGAGTGAAGGGGCTGAACAACGCCGCCCGCACCACCGCCGACCGCCAGGC
GGCCTGCCGCTGCCTCAAGAGCCTCGCCGGCAGCATCAAGTCGCTCAACCTCGGCACCGT
CGCCGGCGTCCCCGGCAAGTGCGGCGTCAACGTCGGCTTCCCCATCAGCCTCTCCACCGA
CTGCAACAACCAGCCATGCGGCGGCTGGGTGACGTCGTGGAGGCGCCTGCGCTGGTGCTG
ACGCCGGCCTCCATGCAGCAGGCCGGCGGGAGGGGGAGCTCCGGCGCCTTGGACGCCAGC
ATGGTCGTCATCCTCGCCGCGCTGCTCTGCGTCGTCATCTGCGCCCTCGGCCTCACCTCC
CTCATCCGCTGCGCGCTCCACTGCGCCCGCGGCCTCTCCCCCACCACGGCGACGCCGACG
CCGTCGGTGTCGACAGCTGCCACGGCCGGGCTGAAGAAGACGGAGCTGAGGAGGATTCCG
GTGGAGGTGTACGGCGCCAAGCAGGCCGGCGTCCCCGACGGCGAGTGCGCCATCTGCCTG
GGCGACTTCGCCGACGGCGACAAGGTGCGCGTGCTCCCGAGGTGCCACCACGGCTTCCAC
GTCCGCTGCATCGACACGTGGCTCGCCGCGCACACGTCCTGCCCTACTTGCCGGGACTCC
ATTCTCTCCGTCCATGGAGTCGTCGCCGGCGGCCAAACATAG

Protein

234 aa

>Os11t0116200-02 Similar to Zinc finger, C3HC4 type family protein, expressed.
MLQRSEGAEQRRPHHRRPPGGLPLPQEPRRQHQVAQPRHRRRRPRQVRRQRRLPHQPLHR
LQQPAMRRLGDVVEAPALVLTPASMQQAGGRGSSGALDASMVVILAALLCVVICALGLTS
LIRCALHCARGLSPTTATPTPSVSTAATAGLKKTELRRIPVEVYGAKQAGVPDGECAICL
GDFADGDKVRVLPRCHHGFHVRCIDTWLAAHTSCPTCRDSILSVHGVVAGGQT*

5'UTR

chr11:722980..723219 (+ strand) : 240 bp

CDS

chr11:723220..723408 (+ strand) : 189 bp

chr11:726204..726716 (+ strand) : 513 bp

3'UTR

chr11:726717..726970 (+ strand) : 254 bp

FASTA

>Os11t0116200-02 class=Sequence position=chr11:722980..726970 (+ strand)
ATCACCGGCG ACGAGGAGAC ACTCACTGAT ATAATCAAGC TAGCTAGCTT AATCACCTAG CTATCCGTCA GTTTAGCTAG
ATATGGCTGC AGTTAACTGC AAGGTGGTGG TCGCCGTGAT TGTGGTGGCG ATGGTGGTTG CGGCGCCGGG GGCGTCGGCG
GCGATAACGT GCGGGCAGGT GGGATCGGCG ATCGCGCCGT GCATCTCGTA CGTGACGGGG AGGAGCGGCC TCACGCAGGG
ATGCTGCAAC GGAGTGAAGG GGCTGAACAA CGCCGCCCGC ACCACCGCCG ACCGCCAGGC GGCCTGCCGC TGCCTCAAGA
GCCTCGCCGG CAGCATCAAG TCGCTCAACC TCGGCACCGT CGCCGGCGTC CCCGGCAAGT GCGGCGTCAA CGTCGGCTTC
CCCATCAGCC TCTCCACCGA CTGCAACAAG TATATCATCT CTCTATGACT CCTCTCTCTC TCTCTATATA TATATATACA
CGcatatatc tctttatttt ttacgtgcta tctaaatact ccctccgttt caggttataa gacgttttaa ctttggttaa
agttaaactt ctctaagttt aactaattct gtagaaaaaa gtaataatat ttaaatacca tcatagtttc attaaatcca
taattgaata aattttcata atatatttgt catgggttaa aaaagatact acttttttac tacaaaatca gtaaaactta
cagtatttta actttaacca aagtcaaaac gtcttataat ctaaaatgga gcaatagtta ataaaaactT TTACAAGTTa
agatagatta ccatatgtga gatatatctc acttcataga cataaaagat taaattcaac ttatacaagt taaattaaaa
aacaaactaa actaacacta gttaacgtat tttcgctatt atatctgtta ttattgttac aacttgtaca agtttaattt
aaacatgtat atttatggac atgcatattt aatattaatc tatcttatca ttttgtttta ctttttaatg gctattaagg
tggggggatg aaagcaacaa tgagatattt ctcgagatat gaaacatttt cccataaAAT AACTACCTAT ATATATGCAT
TTTTTTTCTT TGGTGCAGGG TCAGCTAGAT CAATTAATCC TGCTTGGATC GATCGATCGA GCTTAACACG CTAGCTCGAT
CGGAGTTGAT CAGCTAGTAA TTAAGCACGT ATTTGCTACA GCATATATGA ACAAAGTAAT TAAAATAACA CCTGCGGCAG
ACATGCAGCG CTCCATTCTC TCTCTGTATC AGCTGTATAC TTTATGTTGC ACGCTCCCTG TGTGCATGTT CTATCTTAAT
TTTCTTCAGT ATGTACACGA TCTGTGTGTA CTACGTGTAA TCCTATACGT TTTATGAATT GCATGTTGTC CAAATGTCTT
TGTCCTAGCT ACTAGCTACT CCAGCTTCTT GCTGAGGAAA TCTGCAGTAG TAGTAATCCC TCGTTGTGAT ACGCAACAAA
ATTGTTTAAT GTGATCCTGC TATATATATA GAAAATCATC TCTATTATTT TACAGGCATA AAACAAGTCC ACTCTAAAAA
CAATTAGTGC GGCCGTTGTC TTAATAGACC CGTATGTGAA AATCGTTTTT CACAAGCAGT TCCTTAAGAC AACTTCATGT
ATCATTATTG TAGTATGTCA AAAAGATGCA CCACACTATG CACAGTCATA CAAAATGGCA CTACTACACA ACTGATCTTT
TATCGGGATA TCCATTTCGG ATAGATTTAG AACGGGTATT AGAGATATTT TTAAGCACCG GTTACCaaaa acatctttaa
ttccgattgg tgttataacc ggtactaaag atGCCTACAG GGCTAGTTTA AAAAGAAAAC ATCCATATCC ATGTCTGATG
GGTGGAGTTG GTGGATGGTT ACACGCGTGA GGGCTGAGGT GAGAGATCTT GAGTTCGAAT CACATATCCC ACACATTTTT
TTTATTTCGt atgcatcttt agtaccggtt atttcaactg gtactaaaga tcgagatatt tagtctcgat ttgttagaac
cggttctaca tctaaaacgg ttcccaactg gtgctaaaaa tgggttctcc actagtgtGG CAATACATTT ACATTCACAC
ATTAAGGATT CACATCGTCA CCCATATTCA CGTTGACACT GTCTTTTAAT GTATAATTTA AATGTTCACA TTGTGAATAT
TCGACAATGA TAGGGAGCCC GATCCCTATC TACAAGTCTA AACCTAAGAT TAATTTGATC GACATGAGCT AATGAATAGA
TAAGCGCACT ATCTATTGCT TGAAATGGTA GATCCATTAA TTTCCTTTTC ATATATAGAT TATTGTAAAA AGTTGTCGTT
GGCTGATTGG AAATAGACTT GGGCATGAAA CCTATACCCT CTGCAACTCC ACGTAATCGA AAATCATCCT GGAATAGACC
CAAGGATGAA ATTTAGACCA AGGAACGAAA TTGGGCATCT ATAAGTGTGG GGAGACAAAA ATAAACGGTT TCATAGAGTT
AAATGATCAA AGTTGGAACA ATATTGCAAT AGTTGATGAT TAAATTAATT AATGTGGACT TCTTTAAACC ATATATAGAC
tgtgttcggc agcgctgttc ctaacactac cagtacgcac gaaaaatgaa acggtccatt agcgcgtgat taattaagta
ttagctattt tttttaaaaa aaatgaatta atttgatttt ttttcaaaca actttcgtat agaaactttt taaaaaaaca
caccgtttag cagtttcaaa agcgtgcgca cgaaaaaCAA GGGAGGAGGG TTGAGAAAAA GGGTGCCGAA GTATTGTGCG
CTAGATACTG GTAGGGGCAT TGTTGTCCAT CCTCGGAAGT GGCTCAAATA TAACGTGCCA CGACATTAGC GCCATTTCTT
ACACGAAAAC GAAACAGGGA AAACTAATTG AACAAATAGA GAGATATGTA GCTAGCTAGC TTTCAGAGTC CACTTTTTGA
GAGAGCTCAA TCCAATGTGT GGTTTGGCTG CAGCGACGAA CCAGAATAAT CTCACTCTGC TGGTGCACCC AATCACCAAA
TCCAAAGGAA ATTCAATGTA CAACAAAATT AAAAAGAACA TCTTATAATT TGTCTCCTCC TCCTGCATAT GCTTGACTCC
TAGCTTAACT AGAGGTACCT GCAGCCAGCC ATGCGGCGGC TGGGTGACGT CGTGGAGGCG CCTGCGCTGG TGCTGACGCC
GGCCTCCATG CAGCAGGCCG GCGGGAGGGG GAGCTCCGGC GCCTTGGACG CCAGCATGGT CGTCATCCTC GCCGCGCTGC
TCTGCGTCGT CATCTGCGCC CTCGGCCTCA CCTCCCTCAT CCGCTGCGCG CTCCACTGCG CCCGCGGCCT CTCCCCCACC
ACGGCGACGC CGACGCCGTC GGTGTCGACA GCTGCCACGG CCGGGCTGAA GAAGACGGAG CTGAGGAGGA TTCCGGTGGA
GGTGTACGGC GCCAAGCAGG CCGGCGTCCC CGACGGCGAG TGCGCCATCT GCCTGGGCGA CTTCGCCGAC GGCGACAAGG
TGCGCGTGCT CCCGAGGTGC CACCACGGCT TCCACGTCCG CTGCATCGAC ACGTGGCTCG CCGCGCACAC GTCCTGCCCT
ACTTGCCGGG ACTCCATTCT CTCCGTCCAT GGAGTCGTCG CCGGCGGCCA AACATAGCTA GTAATATAAT TTCTTGAACA
GAAGAGGTCT AAAATGTAAA TAGAATATAG GTGGTAAAGT ACTCCAAAAT TGGGATTGCG TAAATGCAAG GGATTGGACA
CAATGTTTGA AGTGTCTCTG TCACTTGGAT TATCCATCTG TTTAGCTGTT TCTATGAGTT TTCTCCTTTA ATTTGTGTGC
TAGCACATGA TATTTCCCCC AAGATTCGCT GTTCGTTTGT TCTGGGCATA ATTTTGTCAC CACTCAACAA C

Locus: Os11g0116200

Loading...

Locus: Os11g0116200

Loading...