Os11t0119200-01

Locus

Os11g0119200

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP714C3

CGSNL Gene Name

P-450 714C3

Oryzabase Gene Symbol Synonym(s)

CYP714C3

Oryzabase Gene Name Synonym(s)

Cytochrome P450 714C3

Transcript Evidence

AK103124 (DDBJ, Best hit)

Protein Evidence

NP_001148976.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, C3HC4 RING-type (IPR018957)

Full-length cDNA

J033119L05 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0119200-01)

RiceXPro (AK103124)

Others

Oryzabase (12267)

KEGG (Os11t0119200-01)

Transcript

3306 bp

>Os11t0119200-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
GCTCCACTGATTCGATTGGCGTCACCTTCATCAATCGATCGCTGCAGACTGCAGTTGGTT
CCCTCCTCTCCTGCCAACGACCACGAGCCCTAGTTTAGGCCGCCCCCAAATCTACTGCCA
TCCCCGACTAGTATCCCATTTCTCTTGATTTTAAGGGATCCTGAGGGGGATGCTTCCTCT
ACTCTGCTGCAGCAACGCTTGACAAGGCTATCACATCCAATCCAATGGTGCACTGCTGAC
CAACTTCAGTGTCGGGATATCCATGTCTGACCATCAATTTGCCGGCCAACCAGATGTGCA
GTGCCTAGTTTGCACAAGGCCGTTTACTTTGGATGCTCAGGTGACTGATACCTTTGAAGC
TTTAGCCATATGCAGGGACTGCAAGGCCACAGTACTTAACGATGTCGAAAGAGATGAAAT
AACCAGCACTTCTCATCACACAAGACGGAGAAGGCAGAGATCCAGGACTGCAAGTATTGA
TTCCCTGGAGGACGCATTCTCGCAGGAGTTCTCTCAGCTGATCGACTTAGCAAGAAGACA
AGGTCGTGAAACGGATATTGATTCTTCGTCAGTCCTGCCGCAACATGCGTCGTACAATGC
GACACCAAGCCACTCTCAAAGATGGCATGCTTCAGATGACGAGAGCGACGGCCTTAATTA
TGTTGATTCTGTGTTTGGTGAAATTGAATCAACCATCAGTTTTGGTGACTATGGTGCGGA
TTCAGACACCTCCATAGAGGAACATAGTGTATCGGCAAGGAGGAGGATTTCCATTCAACT
TGACAATGGAAGTTACATGAACACAGATACCGATATTGATCCCATGAATGCTAGGCTGGA
TCAGTGGGATTCAGATGACCAGGAAGATGTGGAAGAGTCTGGTTTTGATGAAACAATAAA
CACCATGACCCAGCACCAGCAGCAATCACATGATATTCAGCTAAGTGGATTGAGTGAGGA
CGAATCTGAAGATGGTGTATGGAATTGGAGCGTGGCTGTACGTCAAAGAGCAAACGTGAC
AAACTTGCTAGAGGACATGGAAGGGCCAGAAATGAGGACAACTTTTGTCGGGAATCCAGA
TGATTATGTTGATGCAAGGCAGTTCGAGATGCTCCTTGAGCAATTTGCTGAGGACAACAG
TTCCAGAAGAGGAGCTCCACCAGCTGCTACATCCTTTATTGAAAATCTCCCCTCTGTGAT
TATCTCCACAAGTCATCAGATAAATGATGATGTGATCTGTCCGGTCTGCAAAGATCCAAT
TCCTACCAGAGCTAGAGCAAAACAGCTACCATGCATGCATCTTTATCATTCATCGTGCAT
CTTGCCATGGTTTAGTTCTAGAAATACATGTCCTGTCTGCCGATATGAGCTTCCTACAGA
TGATGCAGAGTATGAAAGGTCCAAGCAAGCCACAACCAATGTAAGAGACATTCAGGTTGT
GGAAGAAAATTCTGATGAACAAGAGGTCCAGGTAACTCGTCAGATGGCTGTTGGTGCTAT
CGAAGAGACTAATACAAGTGAACACAATGTTCGTGTTGATGAGCAACCAAGCAGTGCACG
CAGGCGCAGTGGATGGCTTTTTATTGCTGCTGCTCCAGTCGTAAGCCTTATCGGTTTCGC
TCTAGTTTTATGCTTTACAAATCCTGCTAGGAGTGGTAGAAGGCAACTGTACTGTAGATC
CCCAAGTGCCACTGAAGTACATGTGGGTACCAAAAAGAGTTGGTGGTCTATGTTCTAGAA
TGTTCCGGCGGTACATCTGATAACAAAATGACTATATATGGTGGTGCGTGATTGTTTCTT
TAGAATAGTTTTATTTTAAAATTTTCAAATGTTGTAGTTGCTGCAGTGACCGGTCGGAGT
GTTGTAAAAGAATTCACATGCCTAGTTTCTTCTGCTACTTTGCTCAGTCAAGAAAAGTGT
GTATTGATACTTGCTATTTGTTTAACATATATGTGCCATTGGATATCCTATGCTTCCTTG
ATTCCTTCTGTTGTTGCCTCATTTAAAAATCACCATGGAAGAGAAGACTCCATTTGCATT
CAGTGCTTTTCAGAATTCTACCCAGTGTCCAGTTGAGAAGTAATTCGTCTCCTATTGTTT
GAAGCTCGCGTCTAGGCTTCATTGGTTTGTGCCTCACAAATTTTTTCTGTATGTTAATTC
TTGGTATATTGTTTCTCTCATGAAATGCTTCTGGTAGCTAAAGTAGGTTGTGCATAATGC
AGTATGCTAGCACAGAACTTAAGGCTGGTTTTAGATTGTCATCAGGTAAAACAGGGGGAT
CAAAATGATTTTCTTGCAGTAATTTAGTCTGTTGAATTCACATCGTCATGAACTGGAAGG
TCTAACTGATTGTAAATTGATCCCAAGATGTGAAAGCAACCTACAAAACAATCAGTTGTT
GAAGAAAAGGTCAAACAAAAGAATTCACATGCTTGAGGTGTTAAACAAATATATAAAGCT
AGTGCACGAAAGACCTAATGTACTGAAGATTTGACAGAAATAATTTGCTTCTCTGGTTCC
CTATGCTCATGGAGAAATTGCTTGCACTCATTGTTGTTCTTGTCATACTTCTTAGCTTAG
CTCTGTTCTACTTGTGCAACATCCTATGGCTGAGGGCTGTGAAGATAAGGAAGAAGTTGA
GGAGGCAAGGCATAAGGGGTCCCAAGCCTACTTTTCTCTATGGCAACACCAAGGAGATCA
AAAGAATCCGACAAGAACTCAAACTTTCACAGAAGCAAGGCACCAACAACTTCATCTCCA
CCCTCTTCCCACACTTCCTCCTTTGGCGGGAAACTTATGGCCCAGTGTTCCTATACTCAA
CAGGAGCTATGGAGATACTACAAGTTTCTCACCCAGATATGGTGAAGGATATAGGCCGGT
GGACACCATCAGAGCTTGGTAAGCCTAATTATCTAAAGAAATCTCGCAAGGCCCTCTTTG
GAGGAGGTTTATTTACAGAGAATGGTGATGAATGGGCCTATCAGAGGAAGATAATTGCAC
CAGAGTTCTTCATGGATAAGATTAAGGGTATGATACAGCTAATTGAGGATGCAACCGTTC
CAGTGTTAGAAGCATGGGAGGATATGATTGACGATGAGGGAGGGTGTAGGGAAATAGTTG
TCGATGATTACTTGCGGAACTTGTCAGCAGATGTAATTGCCAGGGCTTGCTTTGGGAGTA
GCTTCACAAAAGGAGAAGAAATATTTTGCAAGCTTAGGCAGCTCCAAAAAGCAATTGCTC
GGCAAGATTCGTTTGTTGGTCTGTCTGCACTGTGGTAAGTCAATGAAATTAGTGGCAATA
AAATGA

CDS

1476 bp

>Os11t0119200-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGTCTGACCATCAATTTGCCGGCCAACCAGATGTGCAGTGCCTAGTTTGCACAAGGCCG
TTTACTTTGGATGCTCAGGTGACTGATACCTTTGAAGCTTTAGCCATATGCAGGGACTGC
AAGGCCACAGTACTTAACGATGTCGAAAGAGATGAAATAACCAGCACTTCTCATCACACA
AGACGGAGAAGGCAGAGATCCAGGACTGCAAGTATTGATTCCCTGGAGGACGCATTCTCG
CAGGAGTTCTCTCAGCTGATCGACTTAGCAAGAAGACAAGGTCGTGAAACGGATATTGAT
TCTTCGTCAGTCCTGCCGCAACATGCGTCGTACAATGCGACACCAAGCCACTCTCAAAGA
TGGCATGCTTCAGATGACGAGAGCGACGGCCTTAATTATGTTGATTCTGTGTTTGGTGAA
ATTGAATCAACCATCAGTTTTGGTGACTATGGTGCGGATTCAGACACCTCCATAGAGGAA
CATAGTGTATCGGCAAGGAGGAGGATTTCCATTCAACTTGACAATGGAAGTTACATGAAC
ACAGATACCGATATTGATCCCATGAATGCTAGGCTGGATCAGTGGGATTCAGATGACCAG
GAAGATGTGGAAGAGTCTGGTTTTGATGAAACAATAAACACCATGACCCAGCACCAGCAG
CAATCACATGATATTCAGCTAAGTGGATTGAGTGAGGACGAATCTGAAGATGGTGTATGG
AATTGGAGCGTGGCTGTACGTCAAAGAGCAAACGTGACAAACTTGCTAGAGGACATGGAA
GGGCCAGAAATGAGGACAACTTTTGTCGGGAATCCAGATGATTATGTTGATGCAAGGCAG
TTCGAGATGCTCCTTGAGCAATTTGCTGAGGACAACAGTTCCAGAAGAGGAGCTCCACCA
GCTGCTACATCCTTTATTGAAAATCTCCCCTCTGTGATTATCTCCACAAGTCATCAGATA
AATGATGATGTGATCTGTCCGGTCTGCAAAGATCCAATTCCTACCAGAGCTAGAGCAAAA
CAGCTACCATGCATGCATCTTTATCATTCATCGTGCATCTTGCCATGGTTTAGTTCTAGA
AATACATGTCCTGTCTGCCGATATGAGCTTCCTACAGATGATGCAGAGTATGAAAGGTCC
AAGCAAGCCACAACCAATGTAAGAGACATTCAGGTTGTGGAAGAAAATTCTGATGAACAA
GAGGTCCAGGTAACTCGTCAGATGGCTGTTGGTGCTATCGAAGAGACTAATACAAGTGAA
CACAATGTTCGTGTTGATGAGCAACCAAGCAGTGCACGCAGGCGCAGTGGATGGCTTTTT
ATTGCTGCTGCTCCAGTCGTAAGCCTTATCGGTTTCGCTCTAGTTTTATGCTTTACAAAT
CCTGCTAGGAGTGGTAGAAGGCAACTGTACTGTAGATCCCCAAGTGCCACTGAAGTACAT
GTGGGTACCAAAAAGAGTTGGTGGTCTATGTTCTAG

Protein

492 aa

>Os11t0119200-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MSDHQFAGQPDVQCLVCTRPFTLDAQVTDTFEALAICRDCKATVLNDVERDEITSTSHHT
RRRRQRSRTASIDSLEDAFSQEFSQLIDLARRQGRETDIDSSSVLPQHASYNATPSHSQR
WHASDDESDGLNYVDSVFGEIESTISFGDYGADSDTSIEEHSVSARRRISIQLDNGSYMN
TDTDIDPMNARLDQWDSDDQEDVEESGFDETINTMTQHQQQSHDIQLSGLSEDESEDGVW
NWSVAVRQRANVTNLLEDMEGPEMRTTFVGNPDDYVDARQFEMLLEQFAEDNSSRRGAPP
AATSFIENLPSVIISTSHQINDDVICPVCKDPIPTRARAKQLPCMHLYHSSCILPWFSSR
NTCPVCRYELPTDDAEYERSKQATTNVRDIQVVEENSDEQEVQVTRQMAVGAIEETNTSE
HNVRVDEQPSSARRRSGWLFIAAAPVVSLIGFALVLCFTNPARSGRRQLYCRSPSATEVH
VGTKKSWWSMF*

5'UTR

chr11:856524..856729 (+ strand) : 206 bp

chr11:856866..856921 (+ strand) : 56 bp

CDS

chr11:856922..858397 (+ strand) : 1476 bp

3'UTR

chr11:858398..859458 (+ strand) : 1061 bp

chr11:860379..860605 (+ strand) : 227 bp

chr11:860701..860980 (+ strand) : 280 bp

FASTA

>Os11t0119200-01 class=Sequence position=chr11:856524..860980 (+ strand)
GCTCCACTGA TTCGATTGGC GTCACCTTCA TCAATCGATC GCTGCAGACT GCAGTTGGTT CCCTCCTCTC CTGCCAACGA
CCACGAGCCC TAGTTTAGGC CGCCCCCAAA TCTACTGCCA TCCCCGACTA GTATCCCATT TCTCTTGATT TTAAGGGATC
CTGAGGGGGA TGCTTCCTCT ACTCTGCTGC AGCAACGCTT GACAAGGTGG AGGTTCCGCT GTTTCTCACC ACTTCTTCTC
TGCAATCTCT AATTTCTGTT CATCTTGTTG AGCATATGCA GCACAATCAC TTTGATACAA CTTCACTGCA GAACTTCCGC
TAACTACAAA TTTTCCCTCC AGGCTATCAC ATCCAATCCA ATGGTGCACT GCTGACCAAC TTCAGTGTCG GGATATCCAT
GTCTGACCAT CAATTTGCCG GCCAACCAGA TGTGCAGTGC CTAGTTTGCA CAAGGCCGTT TACTTTGGAT GCTCAGGTGA
CTGATACCTT TGAAGCTTTA GCCATATGCA GGGACTGCAA GGCCACAGTA CTTAACGATG TCGAAAGAGA TGAAATAACC
AGCACTTCTC ATCACACAAG ACGGAGAAGG CAGAGATCCA GGACTGCAAG TATTGATTCC CTGGAGGACG CATTCTCGCA
GGAGTTCTCT CAGCTGATCG ACTTAGCAAG AAGACAAGGT CGTGAAACGG ATATTGATTC TTCGTCAGTC CTGCCGCAAC
ATGCGTCGTA CAATGCGACA CCAAGCCACT CTCAAAGATG GCATGCTTCA GATGACGAGA GCGACGGCCT TAATTATGTT
GATTCTGTGT TTGGTGAAAT TGAATCAACC ATCAGTTTTG GTGACTATGG TGCGGATTCA GACACCTCCA TAGAGGAACA
TAGTGTATCG GCAAGGAGGA GGATTTCCAT TCAACTTGAC AATGGAAGTT ACATGAACAC AGATACCGAT ATTGATCCCA
TGAATGCTAG GCTGGATCAG TGGGATTCAG ATGACCAGGA AGATGTGGAA GAGTCTGGTT TTGATGAAAC AATAAACACC
ATGACCCAGC ACCAGCAGCA ATCACATGAT ATTCAGCTAA GTGGATTGAG TGAGGACGAA TCTGAAGATG GTGTATGGAA
TTGGAGCGTG GCTGTACGTC AAAGAGCAAA CGTGACAAAC TTGCTAGAGG ACATGGAAGG GCCAGAAATG AGGACAACTT
TTGTCGGGAA TCCAGATGAT TATGTTGATG CAAGGCAGTT CGAGATGCTC CTTGAGCAAT TTGCTGAGGA CAACAGTTCC
AGAAGAGGAG CTCCACCAGC TGCTACATCC TTTATTGAAA ATCTCCCCTC TGTGATTATC TCCACAAGTC ATCAGATAAA
TGATGATGTG ATCTGTCCGG TCTGCAAAGA TCCAATTCCT ACCAGAGCTA GAGCAAAACA GCTACCATGC ATGCATCTTT
ATCATTCATC GTGCATCTTG CCATGGTTTA GTTCTAGAAA TACATGTCCT GTCTGCCGAT ATGAGCTTCC TACAGATGAT
GCAGAGTATG AAAGGTCCAA GCAAGCCACA ACCAATGTAA GAGACATTCA GGTTGTGGAA GAAAATTCTG ATGAACAAGA
GGTCCAGGTA ACTCGTCAGA TGGCTGTTGG TGCTATCGAA GAGACTAATA CAAGTGAACA CAATGTTCGT GTTGATGAGC
AACCAAGCAG TGCACGCAGG CGCAGTGGAT GGCTTTTTAT TGCTGCTGCT CCAGTCGTAA GCCTTATCGG TTTCGCTCTA
GTTTTATGCT TTACAAATCC TGCTAGGAGT GGTAGAAGGC AACTGTACTG TAGATCCCCA AGTGCCACTG AAGTACATGT
GGGTACCAAA AAGAGTTGGT GGTCTATGTT CTAGAATGTT CCGGCGGTAC ATCTGATAAC AAAATGACTA TATATGGTGG
TGCGTGATTG TTTCTTTAGA ATAGTTTTAT TTTAAAATTT TCAAATGTTG TAGTTGCTGC AGTGACCGGT CGGAGTGTTG
TAAAAGAATT CACATGCCTA GTTTCTTCTG CTACTTTGCT CAGTCAAGAA AAGTGTGTAT TGATACTTGC TATTTGTTTA
ACATATATGT GCCATTGGAT ATCCTATGCT TCCTTGATTC CTTCTGTTGT TGCCTCATTT AAAAATCACC ATGGAAGAGA
AGACTCCATT TGCATTCAGT GCTTTTCAGA ATTCTACCCA GTGTCCAGTT GAGAAGTAAT TCGTCTCCTA TTGTTTGAAG
CTCGCGTCTA GGCTTCATTG GTTTGTGCCT CACAAATTTT TTCTGTATGT TAATTCTTGG TATATTGTTT CTCTCATGAA
ATGCTTCTGG TAGCTAAAGT AGGTTGTGCA TAATGCAGTA TGCTAGCACA GAACTTAAGG CTGGTTTTAG ATTGTCATCA
GGTAAAACAG GGGGATCAAA ATGATTTTCT TGCAGTAATT TAGTCTGTTG AATTCACATC GTCATGAACT GGAAGGTCTA
ACTGATTGTA AATTGATCCC AAGATGTGAA AGCAACCTAC AAAACAATCA GTTGTTGAAG AAAAGGTCAA ACAAAAGAAT
TCACATGCTT GAGGTGTTAA ACAAATATAT AAAGCTAGTG CACGAAAGAC CTAATGTACT GAAGATTTGA CAGAAATAAT
TTGCTTCTCT GGTTCCCTAT GCTCATGGAG AAATTGCTTG CACTCATTGT TGTTCTTGTC ATACTTCTTA GCTTAGCTCT
GTTCTACTTG TGCAACATCC TATGGCTGAG GGCTGTGAAG ATAAGGAAGA AGTTGAGGAG GCAAGGCATA AGGGGTCCCA
AGCCTACTTT TCTCTATGGC AACACCAAGG AGATCAAAAG AATCCGACAA GAACTCAAAC TTTCACAGAA GCAAGGCACC
AACAACTTCA TCTCCACCCT CTTCCCACAC TTCCTCCTTT GGCGGGAAAC TTATGGTATG TATATGCTAG TGTTTTGTGA
CTTTGTCCAT GATTGGCTCT TGCACTCATA TGTTCATGAC TCATGAGTAG ATCAGATTGA TGATAGGATC CTGATGTTTA
TTAATGGCAT GTCTTGGAGA AAATTAATCA CCTACAACTG TTGAAGTGAA TTAATGAATT ACCATGGAGA AGCAGGACCC
CGAAGTATCC CTGCTATTAA AATCTAGTTT ATAAGCCTGA ATTGATCATT TAGTAGGGAA TTGGAGAGCA ATCATAACTT
TTTTAATCTC TCCTCTTTTT ACTGTTTTTC AACTTTTAGT AGGATATCAA ATTATATAAA CAGATCAGAC ACTTTTCAGA
GAAATGGTGC CATCACACAT TTTTAAATAT ATATCTAATC GTTTGTTTTG TAATTTTATT TTGTCCAGTT TGGTTGCTAT
TTACCATCCT ACGAAGTTTC TGTTTCAGAT TCTAAACAAG CTCAGATGCT AGTACTGAGA ATTATTAAAC AAGTTTGTCA
GGATCATAAT TATTGATGAA TAGTTTATTT AGACTGTGGG GCCTTTTTAC AGCTTAATAT AATAGCCATT CAACTCTTGA
CAGTCATATA AAGGACTCAG TAGTTGACCA TCAATTAAAA TTTTCATACA CCCATTTTAT ATGTTATCTC GAGTTTTGTG
TTGGATAACT AAACATTTCC CAACTACTTG TAGATTAAGC AGGATCTGAC CTACTTTGGT AGTGAGAATT CTAATACAAT
AACAATCATA TTTATCATTT CCTTTGCTCT GAAAAATGTA AGTTTGACAA TTGATTTCAA TCTTAGAATA GACTATGCTT
TTTATCTCAT TTTCCCTATA TTCATGTCAA ATTTGAGGGA ATGTCCATGT TGAGTTCTTC TTAATGAAGT TAATTTACAT
GTGTATTTTG ACCAGGCCCA GTGTTCCTAT ACTCAACAGG AGCTATGGAG ATACTACAAG TTTCTCACCC AGATATGGTG
AAGGATATAG GCCGGTGGAC ACCATCAGAG CTTGGTAAGC CTAATTATCT AAAGAAATCT CGCAAGGCCC TCTTTGGAGG
AGGTTTATTT ACAGAGAATG GTGATGAATG GGCCTATCAG AGGAAGATAA TTGCACCAGA GTTCTTCATG GATAAGATTA
AGGTACCATT AAATTGTGAT TGCTTGTAGT TTTCATGGAC TGAAAACTAG ATCTCGTATC ACGCGTGATT GCAGTTGTTA
TTTATATATG CATGCAGGGT ATGATACAGC TAATTGAGGA TGCAACCGTT CCAGTGTTAG AAGCATGGGA GGATATGATT
GACGATGAGG GAGGGTGTAG GGAAATAGTT GTCGATGATT ACTTGCGGAA CTTGTCAGCA GATGTAATTG CCAGGGCTTG
CTTTGGGAGT AGCTTCACAA AAGGAGAAGA AATATTTTGC AAGCTTAGGC AGCTCCAAAA AGCAATTGCT CGGCAAGATT
CGTTTGTTGG TCTGTCTGCA CTGTGGTAAG TCAATGAAAT TAGTGGCAAT AAAATGA

Locus: Os11g0119200

Loading...

Locus: Os11g0119200

Loading...