Os11t0131600-00

Locus

Os11g0131600

Description

Similar to YDG/SRA domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET40, SDG733, OsSUVH11

Oryzabase Gene Name Synonym(s)

SET protein 40, SUVH Histone Methyltransferase 11

Transcript Evidence

BT055690 (DDBJ)

Protein Evidence

Q2RB00 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

Functional domain (InterPro)

SET domain (IPR001214)

SRA-YDG (IPR003105)

Pre-SET zinc-binding sub-group (IPR003606)

Post-SET domain (IPR003616)

Pre-SET domain (IPR007728)

Expression Databases

TENOR (Os11t0131600-00)

Others

Oryzabase (13403)

Transcript

1998 bp

>Os11t0131600-00 Similar to YDG/SRA domain containing protein.
ATGGAGAACTCGGAAGATGAAGCAGAGAGTGACAAACTACCCTTAGACTTGGAGCCATTG
CGCTCATTAGCACCAAAGTTTCCTACTATTTTGGGATATGATGTGGAAACTCAATCAACT
GATCCACTGTTAGTTTATGCCACACCATCCATACCTTGCTCCTCATCAGAACAGCCTCAA
GAAGCCCCAGCTTCATTTTCTCTGCCCTTACCAAAGTCACCCGTCCCTATAAAGGCTACA
CCCATCTCAGCGGCATTTCCAACACCGCAACATGAAGATGAATCATCAGATCAAGATTAC
AAGCCCTTTTGCAAGAATAAAAAACCAGCGATGCCGAAGAGAGCCAAGAGGCCCCAGCAA
GCTGAGAAATCCAATGATGCTAACATCAAGCGCAGATCAATAAGGAGGAACCTGGACAAC
GAGTTCAACTTGTGCTCATCCTCATCAGACAACCCAAAGGAATCGGTGGAAGGAATCCTG
ATGATGTTTGATTCACTTCGGCGCCGTGTACTGCAATTGGATGAAAAAGAGGATGCAAGC
AGGCGGGCTGACCTGAAAGCTGGCACTCTCATGATGCAGAACAACCTCAGAATCAACAAT
CATAAGATGATAGGGCATGTGCCTGGTGTTGAAGTCGGTGACATTTTCTTCTTTAGGATT
GAGATGTGCATTGTTGGTTTACATGCACCAGCCATGGGTGGCATTGATTACATCTCTTCT
AAGAACAAAGATGAGACTCTGGCTGTCTGCATCATTTCATCTGGAGGCTATGAGAATGAC
GATGATGACACTGACATTTTGGTGTACACAGGACAGGGAGGCAACAGTCGTCACAAGGAG
AAGCACGATCAGAAGCTTGAGAGAGGTAACCTTGCTCTCATGAACAGCAAGAGCAAGAAG
AATCAGATCAGGGTTGTGCGCAGCGCACAAGACCCCTTCTGTAACTCAGGCAAAATATAT
ATTTATGATGGGCTTTATCGTATCGAAGACACTTGGACAGACACGGCAAAGAACGGATTT
AATGTTTTCAAGTACAAGCTGAGAAGGGACCCAGGACAGCCTGATGGAATTTCACTTTGG
AAGATGACTGAGAAGTGGAAAGCAAATCCTGCCACAAGAGAAAAGGCTATATTGTTGGAT
TTATCATCAAAGGTTGAACACCTACCTGTGTGCCTTGTTAATGATGTTGATGATGAAAAA
GGGCCAAGTCACTTCAATTATGTTGCTGGAGTGAAGTATTTGAGACCTCTTAGGAAGACA
AAACCATTACAATGTTGCAAATGTCCTAGTGTCTGCTTGCCTGGTGACCCTAATTGTTCG
TGTGCGCAACAGAATGGTGGTGATCTTCCTTACAGTGCAACGGGATTGCTGGCAAAGCAC
ACTCCGATGGTTTATGAGTGCTCCTCTAACTGTCAGTGTTCTCATAATTGTCGAAACAGG
ATCACACAGAAGGGTATAAAACTGAACTTTGAGGTTTTCTGGACTGGAGACCGTGGCTGG
GGTCTGCGGTCGTGGGATCCTATCCGTGCTGGCACATTCATTTGTGAGTACGCCGGTGAA
GTCATTGATGAAACTAAGATGGACATAGATGTTGAGGAAGACAAATATACCTTTCGCGCT
TCATGTCCCGGCAATAAGGCTTTAAGCTGGAATTTGGGAGAAGAATTACTTGAAGAAAAA
AGTACGGCTGTGATAACCAAGAACTTTAAGAAACTACCAATCATCATAAGAGCAAACAAT
GAAGGGAATGTGGCTCGTTTTCTGAACCATAGCTGTTCTCCAAATCTCCTTTGGCAAGCT
GTACAGTATGACCATGGCGATGACAGCTACCCACATATCATGTTTTTTGCAATGGAACAT
ATCCCTCCCATGACTGAACTGACTTATGATTATGGTACAAGAGGTGCTCCCCCTGGCTTT
GAGGGAAAACCCTTCAAAGCTTGCAAACTCAAATCATGCCTCTGTGGCTCTAAGCATTGT
CGAGGTTTGTTCTGATAA

CDS

1995 bp

>Os11t0131600-00 Similar to YDG/SRA domain containing protein.
ATGGAGAACTCGGAAGATGAAGCAGAGAGTGACAAACTACCCTTAGACTTGGAGCCATTG
CGCTCATTAGCACCAAAGTTTCCTACTATTTTGGGATATGATGTGGAAACTCAATCAACT
GATCCACTGTTAGTTTATGCCACACCATCCATACCTTGCTCCTCATCAGAACAGCCTCAA
GAAGCCCCAGCTTCATTTTCTCTGCCCTTACCAAAGTCACCCGTCCCTATAAAGGCTACA
CCCATCTCAGCGGCATTTCCAACACCGCAACATGAAGATGAATCATCAGATCAAGATTAC
AAGCCCTTTTGCAAGAATAAAAAACCAGCGATGCCGAAGAGAGCCAAGAGGCCCCAGCAA
GCTGAGAAATCCAATGATGCTAACATCAAGCGCAGATCAATAAGGAGGAACCTGGACAAC
GAGTTCAACTTGTGCTCATCCTCATCAGACAACCCAAAGGAATCGGTGGAAGGAATCCTG
ATGATGTTTGATTCACTTCGGCGCCGTGTACTGCAATTGGATGAAAAAGAGGATGCAAGC
AGGCGGGCTGACCTGAAAGCTGGCACTCTCATGATGCAGAACAACCTCAGAATCAACAAT
CATAAGATGATAGGGCATGTGCCTGGTGTTGAAGTCGGTGACATTTTCTTCTTTAGGATT
GAGATGTGCATTGTTGGTTTACATGCACCAGCCATGGGTGGCATTGATTACATCTCTTCT
AAGAACAAAGATGAGACTCTGGCTGTCTGCATCATTTCATCTGGAGGCTATGAGAATGAC
GATGATGACACTGACATTTTGGTGTACACAGGACAGGGAGGCAACAGTCGTCACAAGGAG
AAGCACGATCAGAAGCTTGAGAGAGGTAACCTTGCTCTCATGAACAGCAAGAGCAAGAAG
AATCAGATCAGGGTTGTGCGCAGCGCACAAGACCCCTTCTGTAACTCAGGCAAAATATAT
ATTTATGATGGGCTTTATCGTATCGAAGACACTTGGACAGACACGGCAAAGAACGGATTT
AATGTTTTCAAGTACAAGCTGAGAAGGGACCCAGGACAGCCTGATGGAATTTCACTTTGG
AAGATGACTGAGAAGTGGAAAGCAAATCCTGCCACAAGAGAAAAGGCTATATTGTTGGAT
TTATCATCAAAGGTTGAACACCTACCTGTGTGCCTTGTTAATGATGTTGATGATGAAAAA
GGGCCAAGTCACTTCAATTATGTTGCTGGAGTGAAGTATTTGAGACCTCTTAGGAAGACA
AAACCATTACAATGTTGCAAATGTCCTAGTGTCTGCTTGCCTGGTGACCCTAATTGTTCG
TGTGCGCAACAGAATGGTGGTGATCTTCCTTACAGTGCAACGGGATTGCTGGCAAAGCAC
ACTCCGATGGTTTATGAGTGCTCCTCTAACTGTCAGTGTTCTCATAATTGTCGAAACAGG
ATCACACAGAAGGGTATAAAACTGAACTTTGAGGTTTTCTGGACTGGAGACCGTGGCTGG
GGTCTGCGGTCGTGGGATCCTATCCGTGCTGGCACATTCATTTGTGAGTACGCCGGTGAA
GTCATTGATGAAACTAAGATGGACATAGATGTTGAGGAAGACAAATATACCTTTCGCGCT
TCATGTCCCGGCAATAAGGCTTTAAGCTGGAATTTGGGAGAAGAATTACTTGAAGAAAAA
AGTACGGCTGTGATAACCAAGAACTTTAAGAAACTACCAATCATCATAAGAGCAAACAAT
GAAGGGAATGTGGCTCGTTTTCTGAACCATAGCTGTTCTCCAAATCTCCTTTGGCAAGCT
GTACAGTATGACCATGGCGATGACAGCTACCCACATATCATGTTTTTTGCAATGGAACAT
ATCCCTCCCATGACTGAACTGACTTATGATTATGGTACAAGAGGTGCTCCCCCTGGCTTT
GAGGGAAAACCCTTCAAAGCTTGCAAACTCAAATCATGCCTCTGTGGCTCTAAGCATTGT
CGAGGTTTGTTCTGA

Protein

665 aa

>Os11t0131600-00 Similar to YDG/SRA domain containing protein.
MENSEDEAESDKLPLDLEPLRSLAPKFPTILGYDVETQSTDPLLVYATPSIPCSSSEQPQ
EAPASFSLPLPKSPVPIKATPISAAFPTPQHEDESSDQDYKPFCKNKKPAMPKRAKRPQQ
AEKSNDANIKRRSIRRNLDNEFNLCSSSSDNPKESVEGILMMFDSLRRRVLQLDEKEDAS
RRADLKAGTLMMQNNLRINNHKMIGHVPGVEVGDIFFFRIEMCIVGLHAPAMGGIDYISS
KNKDETLAVCIISSGGYENDDDDTDILVYTGQGGNSRHKEKHDQKLERGNLALMNSKSKK
NQIRVVRSAQDPFCNSGKIYIYDGLYRIEDTWTDTAKNGFNVFKYKLRRDPGQPDGISLW
KMTEKWKANPATREKAILLDLSSKVEHLPVCLVNDVDDEKGPSHFNYVAGVKYLRPLRKT
KPLQCCKCPSVCLPGDPNCSCAQQNGGDLPYSATGLLAKHTPMVYECSSNCQCSHNCRNR
ITQKGIKLNFEVFWTGDRGWGLRSWDPIRAGTFICEYAGEVIDETKMDIDVEEDKYTFRA
SCPGNKALSWNLGEELLEEKSTAVITKNFKKLPIIIRANNEGNVARFLNHSCSPNLLWQA
VQYDHGDDSYPHIMFFAMEHIPPMTELTYDYGTRGAPPGFEGKPFKACKLKSCLCGSKHC
RGLF*

CDS

chr11:1439583..1441577 (- strand) : 1995 bp

3'UTR

chr11:1439580..1439582 (- strand) : 3 bp

FASTA

>Os11t0131600-00 class=Sequence position=chr11:1439580..1441577 (- strand)
ATGGAGAACT CGGAAGATGA AGCAGAGAGT GACAAACTAC CCTTAGACTT GGAGCCATTG CGCTCATTAG CACCAAAGTT
TCCTACTATT TTGGGATATG ATGTGGAAAC TCAATCAACT GATCCACTGT TAGTTTATGC CACACCATCC ATACCTTGCT
CCTCATCAGA ACAGCCTCAA GAAGCCCCAG CTTCATTTTC TCTGCCCTTA CCAAAGTCAC CCGTCCCTAT AAAGGCTACA
CCCATCTCAG CGGCATTTCC AACACCGCAA CATGAAGATG AATCATCAGA TCAAGATTAC AAGCCCTTTT GCAAGAATAA
AAAACCAGCG ATGCCGAAGA GAGCCAAGAG GCCCCAGCAA GCTGAGAAAT CCAATGATGC TAACATCAAG CGCAGATCAA
TAAGGAGGAA CCTGGACAAC GAGTTCAACT TGTGCTCATC CTCATCAGAC AACCCAAAGG AATCGGTGGA AGGAATCCTG
ATGATGTTTG ATTCACTTCG GCGCCGTGTA CTGCAATTGG ATGAAAAAGA GGATGCAAGC AGGCGGGCTG ACCTGAAAGC
TGGCACTCTC ATGATGCAGA ACAACCTCAG AATCAACAAT CATAAGATGA TAGGGCATGT GCCTGGTGTT GAAGTCGGTG
ACATTTTCTT CTTTAGGATT GAGATGTGCA TTGTTGGTTT ACATGCACCA GCCATGGGTG GCATTGATTA CATCTCTTCT
AAGAACAAAG ATGAGACTCT GGCTGTCTGC ATCATTTCAT CTGGAGGCTA TGAGAATGAC GATGATGACA CTGACATTTT
GGTGTACACA GGACAGGGAG GCAACAGTCG TCACAAGGAG AAGCACGATC AGAAGCTTGA GAGAGGTAAC CTTGCTCTCA
TGAACAGCAA GAGCAAGAAG AATCAGATCA GGGTTGTGCG CAGCGCACAA GACCCCTTCT GTAACTCAGG CAAAATATAT
ATTTATGATG GGCTTTATCG TATCGAAGAC ACTTGGACAG ACACGGCAAA GAACGGATTT AATGTTTTCA AGTACAAGCT
GAGAAGGGAC CCAGGACAGC CTGATGGAAT TTCACTTTGG AAGATGACTG AGAAGTGGAA AGCAAATCCT GCCACAAGAG
AAAAGGCTAT ATTGTTGGAT TTATCATCAA AGGTTGAACA CCTACCTGTG TGCCTTGTTA ATGATGTTGA TGATGAAAAA
GGGCCAAGTC ACTTCAATTA TGTTGCTGGA GTGAAGTATT TGAGACCTCT TAGGAAGACA AAACCATTAC AATGTTGCAA
ATGTCCTAGT GTCTGCTTGC CTGGTGACCC TAATTGTTCG TGTGCGCAAC AGAATGGTGG TGATCTTCCT TACAGTGCAA
CGGGATTGCT GGCAAAGCAC ACTCCGATGG TTTATGAGTG CTCCTCTAAC TGTCAGTGTT CTCATAATTG TCGAAACAGG
ATCACACAGA AGGGTATAAA ACTGAACTTT GAGGTTTTCT GGACTGGAGA CCGTGGCTGG GGTCTGCGGT CGTGGGATCC
TATCCGTGCT GGCACATTCA TTTGTGAGTA CGCCGGTGAA GTCATTGATG AAACTAAGAT GGACATAGAT GTTGAGGAAG
ACAAATATAC CTTTCGCGCT TCATGTCCCG GCAATAAGGC TTTAAGCTGG AATTTGGGAG AAGAATTACT TGAAGAAAAA
AGTACGGCTG TGATAACCAA GAACTTTAAG AAACTACCAA TCATCATAAG AGCAAACAAT GAAGGGAATG TGGCTCGTTT
TCTGAACCAT AGCTGTTCTC CAAATCTCCT TTGGCAAGCT GTACAGTATG ACCATGGCGA TGACAGCTAC CCACATATCA
TGTTTTTTGC AATGGAACAT ATCCCTCCCA TGACTGAACT GACTTATGAT TATGGTACAA GAGGTGCTCC CCCTGGCTTT
GAGGGAAAAC CCTTCAAAGC TTGCAAACTC AAATCATGCC TCTGTGGCTC TAAGCATTGT CGAGGTTTGT TCTGATAA

Locus: Os11g0131600

Loading...

Locus: Os11g0131600

Loading...