Os11t0135000-01

Locus

Os11g0135000

Description

Efflux transporter of phytosiderophores, Metal transport

RAP-DB Gene Symbol Synonym(s)

TOM2

RAP-DB Gene Name Synonym(s)

transporter of mugineic acid family phytosiderophores 2

CGSNL Gene Symbol

ZIFL5

CGSNL Gene Name

ZINC-INDUCED FACILITATOR-LIKE 5

Oryzabase Gene Symbol Synonym(s)

OsZIFL5, OsTOM2, TOM2

Oryzabase Gene Name Synonym(s)

zinc-induced facilitator-like 5, Transporter of mugineic acids 2

Transcript Evidence

AK121911

Protein Evidence

Q2RAW4

Literature

PMID: 26432636

Note

Manual Curation

February 13, 2020

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral component of plasma membrane (GO:0005887)

Functional domain (InterPro)

MFS transporter superfamily (IPR036259)

Major facilitator superfamily (IPR011701)

Major facilitator superfamily domain (IPR020846)

Experimentally confirmed subcellular location

cell membrane (GO:0005886)

Full-length cDNA

J033105P18 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0135000-01)

RiceXPro (AK121911)

Others

Oryzabase (9474)

KEGG (Os11t0135000-01)

Transcript

1851 bp

>Os11t0135000-01 Efflux transporter of phytosiderophores, Metal transport
GTTGTTTGCCTTTGTCAATCTCCACCACATCATCTCCTACCTCGTCCTGCCTGCGGTGGC
CTTCTCCTGCCTCTGCCTGCTTCACAAGTCCTTCTCTGACTCTGTCTTGGCCATCCTATT
CCTAGCTCATCATCACACTCTTGCATACGTGCTTGTTGTCAACTCCATTGAGAGCGTCGC
CGTTGATGGCTGAGCCGCCGGCGACCAAGGTATACCACGATGGCTGCCCCGGCTGCGCCA
TGGAGCAGAGGAAGGAGGAGCACAAGGGCATTCCCTACAAGGAGTTCCTCTTCGTTGCCA
TCACCACCCTCGCCTCCTCTCTGCCAATCTCTTCCTTGTTCCCCTTCTTGTACTTCATGA
TAAGGGAATTGCATATTTCTCGGACAGAGGAAGATATTGGATTCTATGCTGGATTTCTTG
GCGCATCATATATGATCGGTCGAGGTTTTGCATCAATCTTGTGGGGTATGGTAGCGGATC
GTATTGGCCGAAAGCCTGTCATTATCTTTTCCATTTTTGCAGTCATTGTGCTCAATACTT
TGTTTGGATTAAGTGTGAAGTACTGGATGGCTGTTACCACGAGATTCCTTCTTGGTGCTC
TGAATGGATTGCTTGCACCAATAAAGGCTTACTCTATCGAAGTTTGCCGAGCTGAACATC
AAGCTCTGGGCCTATCAATTGTGAGCACAGCATGGGGAATAGGTCTTGTAGTTGGTCCAG
CAATTGGAGGCTACCTCGCGCAGCCTGTCAAACAATATCCTCATCTTTTTCATGAAAAGT
CAATATTTGGGAGATTTCCATACCTTCTACCCTGTCTTTGTATATCACTTTTTGCTCTCT
TGGTCCTCATAAGCTGTATATGGCTACCGGAGACCCTACATAAGCATAAAGGCCTTGAAA
CAGGAGTGGAGGCAGCTGAAGCTTCTACTACTCAAGGAAGTGCAGAATCACATAAGAAAA
GTTTATTCAGAAATTGGCCATTGATGTCATCTATCATCACATATTGTGTCTTCTCCCTTC
ACGACACCGCATATAGCGAGatattttctctgtggactgtaagtgatagaaaatatggtg
gactcagcttttcatctaaagatgttgggcaagttcttgcagtggcagGTGCCAGCCTTC
TTGTATATCAACTTTTTATCTACCGTTGGGTTGATAAAATTCTTGGACCTATCAACTCAA
CCCGCATTGCGTCGGTACTATCTATACCGATTATTGCTGCTTATCCCTTTATGACGCACT
TATCAGGAATAAGACTTGGTGTGGCCCTCTATAGTGCAGCAATGATCAAAAGTGTTCTTG
CTATAACTATAATTACGGGCACTTCTCTTCTACAAAACAAAGCAGTGCCACAAGGGCAAC
GGGGTGCTGCAAACGGAATAGCTACAACGGCCATGTCCTTGTTCAAGGCTGTTGCACCAG
CTGGCGCAGGTGTTCTATTCTCTTGGGCACAAAAGCGACAGCATGCAGCATTTTTTCCAG
GTGATCAGATGGTGTTTCTTTTACTGAACCTGACTGAGGTCATTGGACTCATGTTGACCT
TCAAACCTTTCTTGGCGGTTCCTCAACAATACAAATAGAACATTCAGATACTGTCAGCTG
GTGTGGCAAACACCATAGAGAGATAGTTGTAGCTAGTACTATGTTTTAGTATTAAAACAT
GGTTTAGATATGGTTGTAGCAGAGTGTTAGAAACATGCACCATTCCAGGTGCAGAGCCTC
TGTTAGGTTGTTCTTCTTTTTGTTCTGCTTTGGGTCTGTGAGATAAATAATCTTGCAAAA
GCTATGACATTTTTTATTGCAGCTTTGGAGTACAACACATCAGATTTGCGC

CDS

1413 bp

>Os11t0135000-01 Efflux transporter of phytosiderophores, Metal transport
ATGGCTGAGCCGCCGGCGACCAAGGTATACCACGATGGCTGCCCCGGCTGCGCCATGGAG
CAGAGGAAGGAGGAGCACAAGGGCATTCCCTACAAGGAGTTCCTCTTCGTTGCCATCACC
ACCCTCGCCTCCTCTCTGCCAATCTCTTCCTTGTTCCCCTTCTTGTACTTCATGATAAGG
GAATTGCATATTTCTCGGACAGAGGAAGATATTGGATTCTATGCTGGATTTCTTGGCGCA
TCATATATGATCGGTCGAGGTTTTGCATCAATCTTGTGGGGTATGGTAGCGGATCGTATT
GGCCGAAAGCCTGTCATTATCTTTTCCATTTTTGCAGTCATTGTGCTCAATACTTTGTTT
GGATTAAGTGTGAAGTACTGGATGGCTGTTACCACGAGATTCCTTCTTGGTGCTCTGAAT
GGATTGCTTGCACCAATAAAGGCTTACTCTATCGAAGTTTGCCGAGCTGAACATCAAGCT
CTGGGCCTATCAATTGTGAGCACAGCATGGGGAATAGGTCTTGTAGTTGGTCCAGCAATT
GGAGGCTACCTCGCGCAGCCTGTCAAACAATATCCTCATCTTTTTCATGAAAAGTCAATA
TTTGGGAGATTTCCATACCTTCTACCCTGTCTTTGTATATCACTTTTTGCTCTCTTGGTC
CTCATAAGCTGTATATGGCTACCGGAGACCCTACATAAGCATAAAGGCCTTGAAACAGGA
GTGGAGGCAGCTGAAGCTTCTACTACTCAAGGAAGTGCAGAATCACATAAGAAAAGTTTA
TTCAGAAATTGGCCATTGATGTCATCTATCATCACATATTGTGTCTTCTCCCTTCACGAC
ACCGCATATAGCGAGatattttctctgtggactgtaagtgatagaaaatatggtggactc
agcttttcatctaaagatgttgggcaagttcttgcagtggcagGTGCCAGCCTTCTTGTA
TATCAACTTTTTATCTACCGTTGGGTTGATAAAATTCTTGGACCTATCAACTCAACCCGC
ATTGCGTCGGTACTATCTATACCGATTATTGCTGCTTATCCCTTTATGACGCACTTATCA
GGAATAAGACTTGGTGTGGCCCTCTATAGTGCAGCAATGATCAAAAGTGTTCTTGCTATA
ACTATAATTACGGGCACTTCTCTTCTACAAAACAAAGCAGTGCCACAAGGGCAACGGGGT
GCTGCAAACGGAATAGCTACAACGGCCATGTCCTTGTTCAAGGCTGTTGCACCAGCTGGC
GCAGGTGTTCTATTCTCTTGGGCACAAAAGCGACAGCATGCAGCATTTTTTCCAGGTGAT
CAGATGGTGTTTCTTTTACTGAACCTGACTGAGGTCATTGGACTCATGTTGACCTTCAAA
CCTTTCTTGGCGGTTCCTCAACAATACAAATAG

Protein

471 aa

>Os11t0135000-01 Efflux transporter of phytosiderophores, Metal transport
MAEPPATKVYHDGCPGCAMEQRKEEHKGIPYKEFLFVAITTLASSLPISSLFPFLYFMIR
ELHISRTEEDIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVLNTLF
GLSVKYWMAVTTRFLLGALNGLLAPIKAYSIEVCRAEHQALGLSIVSTAWGIGLVVGPAI
GGYLAQPVKQYPHLFHEKSIFGRFPYLLPCLCISLFALLVLISCIWLPETLHKHKGLETG
VEAAEASTTQGSAESHKKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVSDRKYGGL
SFSSKDVGQVLAVAGASLLVYQLFIYRWVDKILGPINSTRIASVLSIPIIAAYPFMTHLS
GIRLGVALYSAAMIKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAVAPAG
AGVLFSWAQKRQHAAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQYK*

5'UTR

chr11:1631227..1631411 (- strand) : 185 bp

CDS

chr11:1631094..1631226 (- strand) : 133 bp

chr11:1630905..1630945 (- strand) : 41 bp

chr11:1630757..1630817 (- strand) : 61 bp

chr11:1630345..1630447 (- strand) : 103 bp

chr11:1630117..1630219 (- strand) : 103 bp

chr11:1629920..1629973 (- strand) : 54 bp

chr11:1629754..1629816 (- strand) : 63 bp

chr11:1629596..1629645 (- strand) : 50 bp

chr11:1629437..1629512 (- strand) : 76 bp

chr11:1628994..1629164 (- strand) : 171 bp

chr11:1628589..1628676 (- strand) : 88 bp

chr11:1628369..1628454 (- strand) : 86 bp

chr11:1628116..1628223 (- strand) : 108 bp

chr11:1627705..1627749 (- strand) : 45 bp

chr11:1627509..1627597 (- strand) : 89 bp

chr11:1627001..1627044 (- strand) : 44 bp

chr11:1626739..1626836 (- strand) : 98 bp

3'UTR

chr11:1626486..1626738 (- strand) : 253 bp

FASTA

>Os11t0135000-01 class=Sequence position=chr11:1626486..1631411 (- strand)
GTTGTTTGCC TTTGTCAATC TCCACCACAT CATCTCCTAC CTCGTCCTGC CTGCGGTGGC CTTCTCCTGC CTCTGCCTGC
TTCACAAGTC CTTCTCTGAC TCTGTCTTGG CCATCCTATT CCTAGCTCAT CATCACACTC TTGCATACGT GCTTGTTGTC
AACTCCATTG AGAGCGTCGC CGTTGATGGC TGAGCCGCCG GCGACCAAGG TATACCACGA TGGCTGCCCC GGCTGCGCCA
TGGAGCAGAG GAAGGAGGAG CACAAGGGCA TTCCCTACAA GGAGTTCCTC TTCGTTGCCA TCACCACCCT CGCCTCCTGT
ATGAATATAT AATATAGAAT TAGCACGCAT ACATGCACAG TCAACTTAGT TTGATTTGAT GTTTGTTTAT CTCTTCTTGG
TCTTATCTTA TTTTACTTAG TACGTAGTAA CATGCATCCT TCTCTGTCTC TCCCCTTGAT TTTCAGCTCT GCCAATCTCT
TCCTTGTTCC CCTTCTTGTA CTTCATGGTA AGTTTAATCT CCATGCATTC CATTCAATTT CATGAAACAT ATATTTTGCA
AAAGATACTA AATGCATTCC CTTCTTTACA ACAGATAAGG GAATTGCATA TTTCTCGGAC AGAGGAAGAT ATTGGATTCT
ATGCTGGATT TCTTGGTATT AACATTTCTG AAAAATAATT AGTCACTGAG TAACAAAATT CACGAACACT TCTTTCACAA
CTACGTCAAA AATCCACTAA TGTTTACATG atgagaaatt ttataatcct tgaaaaagta tctcgatata cctaaatttt
acactcaaac actgtaaaag ttctcttttt tctttttgtt ttggtacatc gaggtactta gtactagagg taccaaattt
tacactagaa aatgtggtat ttcccggtac tttttcaagg atgataaaat tacccttaCA TGATACTCCA TATTTCTGCT
GCAGGCGCAT CATATATGAT CGGTCGAGGT TTTGCATCAA TCTTGTGGGG TATGGTAGCG GATCGTATTG GCCGAAAGCC
TGTCATTATC TTTTCCATTT TTGCAGTGTA AGCACTATAG TACCTTTCCA AAAATATTGA CAGGAATGTG TCCATGGCCT
ATTGGCATTT ACTTTGTAGT CTGTTCCATC TGCTAAACAA TTTTTAACTC GTCTTCGAAT CTATACTTTC AGCATTGTGC
TCAATACTTT GTTTGGATTA AGTGTGAAGT ACTGGATGGC TGTTACCACG AGATTCCTTC TTGGTGCTCT GAATGGATTG
CTTGCACCAA TAAAGGTACC TTTTTAGGAA ACATTAAGAT ACTTTGAAAT GTGAAAGAAG TCTGTTGAGA ACAAATAAGG
GATGGTGTCA GTATCAATTG GTATTCTTAT TCCATCAACA ATCTACTTAA TTATGTTTTA TATTACTTGT GGCTGCAGGC
TTACTCTATC GAAGTTTGCC GAGCTGAACA TCAAGCTCTG GGCCTATCAA TTGTAAAATA CAAATCTATA TATAGCACTT
CACATCTATA TATATGATGG CATAACTTTG TTTCATGTCA TGGACTAAGT TTCATCCATG TCATCAAAAT TTTAGGTGAG
CACAGCATGG GGAATAGGTC TTGTAGTTGG TCCAGCAATT GGAGGCTACC TCGCGCAGGT AATATTAGAT AAGCATATTC
GGGTTCATAA ATATCCTTTT CTTCTTTTGT GAATGATCGA TGACAATGAG TATTTATCTT TACCTTGGTC TATTTCTTGA
TATCAGCCTG TCAAACAATA TCCTCATCTT TTTCATGAAA AGTCAATATT TGGGAGGTAT TTTTCCTATT GAAAACCGGT
TCTTCAGATT TAATGAGAAA TATTATGCAA TTGTAAATGT GTGATTGCAA ATTGTGCAGA TTTCCATACC TTCTACCCTG
TCTTTGTATA TCACTTTTTG CTCTCTTGGT CCTCATAAGC TGTATATGGC TACCGGTATG TATTACTATT TGTTAAGTTG
CATTATTAAG ATTATATATT CTATTTCCAT GATTCCAACT GCAAGAATTT TGTGTATCTC TTTTATGATC AGTTTCTAAA
TAAGACTGCC TTGTTGGATA ACCAAAAGAA CCAAGACAGA TACCCAAACT AACCGCATGA ACCATGTGCC TGACTGCCTG
GTCTACCAAC CCTTTGTAAA CCTTGCGCAT GACTTAATCT CTATTATCAT TTTTTATGAC TGCATATTTC TTTGATCAAC
TAAATAGGAG ACCCTACATA AGCATAAAGG CCTTGAAACA GGAGTGGAGG CAGCTGAAGC TTCTACTACT CAAGGAAGTG
CAGAATCACA TAAGAAAAGT TTATTCAGAA ATTGGCCATT GATGTCATCT ATCATCACAT ATTGTGTCTT CTCCCTTCAC
GACACCGCAT ATAGCGAGGT AGTAACAGTT ATTAATGTGA TATGAAATTG TTATTATGTA ACCTCTCTAT GTCAAATAAT
TATCTTGCCT TTCTCCATAA AGAGCATGTT TCTTGCTCTA TAAATAAGCT GACAATGCAT TTGCGGTAAT AAACCTTTCA
TATTTATCCA TGGCAATATT TTTCTTTCAG TTAATCATAT ATCTCTAAGT TATGTGTTGT CATACCCAAG TATTAGCAAA
TTCTTCCATT TTAGTCTATG AATATTGATC TATCAAAAAT CAAATATGCT ATGTGAAAAA TGTAATTTTC TAAACATTAT
TTTTTTtaac atcagatatt ttctctgtgg actgtaagtg atagaaaata tggtggactc agcttttcat ctaaagatgt
tgggcaagtt cttgcagtgg caggtaaGTC AAATTCAATC AATTTCTTTC CTACAAATTT TAAACATAGG AAACTCTTTA
ATCACAGGGT GTTTGCATTA ATGTTGAGCT GTGACATGTT GGTTTGGAAA GGTGAACATG TTTTTGTTAC ACTGTAGGTG
CCAGCCTTCT TGTATATCAA CTTTTTATCT ACCGTTGGGT TGATAAAATT CTTGGACCTA TCAACTCAAC CCGCATTGCG
TCGGTGAGTT ACTAATTTCA ATGTTTCATA GTTTCTCATA TACTTGGTAC AGTTTACTTA TTATTGGTTA CCGAGAGGTT
TAAGAGAAAA GAGTTCAAAG AATTATTGGT TAATGCCTGC TTTTATCAGC TGACCTTTAG CATTGCAGGT ACTATCTATA
CCGATTATTG CTGCTTATCC CTTTATGACG CACTTATCAG GAATAAGACT TGGTGTGGCC CTCTATAGTG CAGCAATGAT
CAAAAGTGTT CTTGCTGTAA GTACTTTATG AACCTATGAT TTATATTTTT AAAAAAAAAT AATTCTAAAA GTATAAACTC
TCATATATAT TTTTTAGTAA ACCTGTTGGC TACTCCACTC AAGGAAGCAT GGTAAACAAA TACTTAGCAA AGGCATTATT
GCACCTTTGG TCGTGGAGCC TGTGGGTGGT CTGACCAAAA GGTTCAGATG TGAAAATAAA AAAAATGTTA ATATTTAAAA
AAGTGGTTGA AAAATCCACG AGCTTGCAGT TCTGAAATTT AGCTAGCACT TCAACTGCAC AAAGTTATAT GCTAAAATGT
ATGCTAGGTA ATTTAGTTTA TTTGCACATT TGAAGATACT AATATTTCGT AATGTTGATC AGATAACTAT AATTACGGGC
ACTTCTCTTC TACAAAACAA AGCAGTGGTA CTTGTCCCAC TTATCTGATC TCACTTGACT ATTGTCTGAC AGCCTCACAA
AAGAAAAGAA ATTTTTCTGA CATTTTTTTT TTGAAAAATG CATTATTTTG ACAGCCACAA GGGCAACGGG GTGCTGCAAA
CGGAATAGCT ACAACGGCCA TGTCCTTGTT CAAGGCTGTT GCACCAGCTG GCGCAGGTGT TCTGTAAGTA CAAATCTAAT
TGTCTACAAC TCTTGATTAT AAACTAACAG TTGAACAGAA CTACTAGATA TATGGACAAC ATTTTTTAGA AAATGGATTA
AACTGGCCTC TACATCCAAA ATACATGTAC ACGGCAAAAG ATATATGGAC AACATAATTG TCGCTTTTCA CAAATACTAC
AGGAGTATGA CCATCAGTGG TGTTTACCAT TTGGGCTGTG TACATCCATT GTGGATGTAG AGGCCGGATT TTAATCCATT
TTCTAAAAAA AAAAGTGGTA CTTACCATTT GTTTGACACA AACTGTGGTC ATGAAAAATG TTAGTGGCTA GTTTGTCCTT
CCAAGTTTAG TGAATAGTTG TTGCCTGAAG CCTGAAGATA GATATGAAAG GATGAGCCTG TTCTAACAGA ACTGTAAACC
TGTTTTGAAG AAGAAAAGGA CTGACTGTTG AAAATCTGTG GCTGCAGATT CTCTTGGGCA CAAAAGCGAC AGCATGCAGC
ATTTTTTCCA GGTAAATACT CCTATGCATT TTTATGAACC ATGTTGCAGC CATTACTACA GTACTTTATA TAAGTGAAGT
AAACAAATCG GTGTTGTGAA TTACTAGCAC ATACAAGAAA TAGAAACTTG TGTTATGTTG ATTTGATCAT AAAATGGAAA
TTCAATGTTG TGCAGGTGAT CAGATGGTGT TTCTTTTACT GAACCTGACT GAGGTCATTG GACTCATGTT GACCTTCAAA
CCTTTCTTGG CGGTTCCTCA ACAATACAAA TAGAACATTC AGATACTGTC AGCTGGTGTG GCAAACACCA TAGAGAGATA
GTTGTAGCTA GTACTATGTT TTAGTATTAA AACATGGTTT AGATATGGTT GTAGCAGAGT GTTAGAAACA TGCACCATTC
CAGGTGCAGA GCCTCTGTTA GGTTGTTCTT CTTTTTGTTC TGCTTTGGGT CTGTGAGATA AATAATCTTG CAAAAGCTAT
GACATTTTTT ATTGCAGCTT TGGAGTACAA CACATCAGAT TTGCGC

Locus: Os11g0135000

Loading...

Locus: Os11g0135000

Loading...