Os11t0135000-02

Locus

Os11g0135000

Description

Similar to Major facilitator superfamily antiporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ZIFL5

CGSNL Gene Name

ZINC-INDUCED FACILITATOR-LIKE 5

Oryzabase Gene Symbol Synonym(s)

OsZIFL5, OsTOM2, TOM2

Oryzabase Gene Name Synonym(s)

zinc-induced facilitator-like 5, Transporter of mugineic acids 2

Transcript Evidence

AK066565 (DDBJ, Best hit)

Protein Evidence

Q8H6D5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Major facilitator superfamily (IPR011701)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Major facilitator superfamily domain (IPR020846)

Full-length cDNA

J013072J11 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0135000-02)

RiceXPro (AK066565)

Others

Oryzabase (9474)

KEGG (Os11t0135000-02)

Transcript

1342 bp

>Os11t0135000-02 Similar to Major facilitator superfamily antiporter.
AATTTTTAACTCGTCTTCGAATCTATACTTTCAGCATTGTGCTCAATACTTTGTTTGGAT
TAAGTGTGAAGTACTGGATGGCTGTTACCACGAGATTCCTTCTTGGTGCTCTGAATGGAT
TGCTTGCACCAATAAAGGCTTACTCTATCGAAGTTTGCCGAGCTGAACATCAAGCTCTGG
GCCTATCAATTGTGAGCACAGCATGGGGAATAGGTCTTGTAGTTGGTCCAGCAATTGGAG
GCTACCTCGCGCAGCCTGTCAAACAATATCCTCATCTTTTTCATGAAAAGTCAATATTTG
GGAGATTTCCATACCTTCTACCCTGTCTTTGTATATCACTTTTTGCTCTCTTGGTCCTCA
TAAGCTGTATATGGCTACCGGAGACCCTACATAAGCATAAAGGCCTTGAAACAGGAGTGG
AGGCAGCTGAAGCTTCTACTACTCAAGGAAGTGCAGAATCACATAAGAAAAGTTTATTCA
GAAATTGGCCATTGATGTCATCTATCATCACATATTGTGTCTTCTCCCTTCACGACACCG
CATATAGCGAGatattttctctgtggactgtaagtgatagaaaatatggtggactcagct
tttcatctaaagatgttgggcaagttcttgcagtggcagGTGCCAGCCTTCTTGTATATC
AACTTTTTATCTACCGTTGGGTTGATAAAATTCTTGGACCTATCAACTCAACCCGCATTG
CGTCGGTACTATCTATACCGATTATTGCTGCTTATCCCTTTATGACGCACTTATCAGGAA
TAAGACTTGGTGTGGCCCTCTATAGTGCAGCAATGATCAAAAGTGTTCTTGCTATAACTA
TAATTACGGGCACTTCTCTTCTACAAAACAAAGCAGTGCCACAAGGGCAACGGGGTGCTG
CAAACGGAATAGCTACAACGGCCATGTCCTTGTTCAAGGCTGTTGCACCAGCTGGCGCAG
GTGTTCTATTCTCTTGGGCACAAAAGCGACAGCATGCAGCATTTTTTCCAGGTGATCAGA
TGGTGTTTCTTTTACTGAACCTGACTGAGGTCATTGGACTCATGTTGACCTTCAAACCTT
TCTTGGCGGTTCCTCAACAATACAAATAGAACATTCAGATACTGTCAGCTGGTGTGGCAA
ACACCATAGAGAGATAGTTGTAGCTAGTACTATGTTTTAGTATTAAAACATGGTTTAGAT
ATGGTTGTAGCAGAGTGTTAGAAACATGCACCATTCCAGGTGCAGAGCCTCTGTTAGGTT
GTTCTTCTTTTTGTTCTGCTTTGGGTCTGTGAGATAAATAATCTTGCAAAAGCTATGACA
TTTTTTATTGCAGCTTTGGAGT

CDS

1107 bp

>Os11t0135000-02 Similar to Major facilitator superfamily antiporter.
TTTTTAACTCGTCTTCGAATCTATACTTTCAGCATTGTGCTCAATACTTTGTTTGGATTA
AGTGTGAAGTACTGGATGGCTGTTACCACGAGATTCCTTCTTGGTGCTCTGAATGGATTG
CTTGCACCAATAAAGGCTTACTCTATCGAAGTTTGCCGAGCTGAACATCAAGCTCTGGGC
CTATCAATTGTGAGCACAGCATGGGGAATAGGTCTTGTAGTTGGTCCAGCAATTGGAGGC
TACCTCGCGCAGCCTGTCAAACAATATCCTCATCTTTTTCATGAAAAGTCAATATTTGGG
AGATTTCCATACCTTCTACCCTGTCTTTGTATATCACTTTTTGCTCTCTTGGTCCTCATA
AGCTGTATATGGCTACCGGAGACCCTACATAAGCATAAAGGCCTTGAAACAGGAGTGGAG
GCAGCTGAAGCTTCTACTACTCAAGGAAGTGCAGAATCACATAAGAAAAGTTTATTCAGA
AATTGGCCATTGATGTCATCTATCATCACATATTGTGTCTTCTCCCTTCACGACACCGCA
TATAGCGAGatattttctctgtggactgtaagtgatagaaaatatggtggactcagcttt
tcatctaaagatgttgggcaagttcttgcagtggcagGTGCCAGCCTTCTTGTATATCAA
CTTTTTATCTACCGTTGGGTTGATAAAATTCTTGGACCTATCAACTCAACCCGCATTGCG
TCGGTACTATCTATACCGATTATTGCTGCTTATCCCTTTATGACGCACTTATCAGGAATA
AGACTTGGTGTGGCCCTCTATAGTGCAGCAATGATCAAAAGTGTTCTTGCTATAACTATA
ATTACGGGCACTTCTCTTCTACAAAACAAAGCAGTGCCACAAGGGCAACGGGGTGCTGCA
AACGGAATAGCTACAACGGCCATGTCCTTGTTCAAGGCTGTTGCACCAGCTGGCGCAGGT
GTTCTATTCTCTTGGGCACAAAAGCGACAGCATGCAGCATTTTTTCCAGGTGATCAGATG
GTGTTTCTTTTACTGAACCTGACTGAGGTCATTGGACTCATGTTGACCTTCAAACCTTTC
TTGGCGGTTCCTCAACAATACAAATAG

Protein

369 aa

>Os11t0135000-02 Similar to Major facilitator superfamily antiporter.
FLTRLRIYTFSIVLNTLFGLSVKYWMAVTTRFLLGALNGLLAPIKAYSIEVCRAEHQALG
LSIVSTAWGIGLVVGPAIGGYLAQPVKQYPHLFHEKSIFGRFPYLLPCLCISLFALLVLI
SCIWLPETLHKHKGLETGVEAAEASTTQGSAESHKKSLFRNWPLMSSIITYCVFSLHDTA
YSEIFSLWTVSDRKYGGLSFSSKDVGQVLAVAGASLLVYQLFIYRWVDKILGPINSTRIA
SVLSIPIIAAYPFMTHLSGIRLGVALYSAAMIKSVLAITIITGTSLLQNKAVPQGQRGAA
NGIATTAMSLFKAVAPAGAGVLFSWAQKRQHAAFFPGDQMVFLLLNLTEVIGLMLTFKPF
LAVPQQYK*

5'UTR

chr11:1630252..1630253 (- strand) : 2 bp

CDS

chr11:1630117..1630251 (- strand) : 135 bp

chr11:1629920..1629973 (- strand) : 54 bp

chr11:1629754..1629816 (- strand) : 63 bp

chr11:1629596..1629645 (- strand) : 50 bp

chr11:1629437..1629512 (- strand) : 76 bp

chr11:1628994..1629164 (- strand) : 171 bp

chr11:1628589..1628676 (- strand) : 88 bp

chr11:1628369..1628454 (- strand) : 86 bp

chr11:1628116..1628223 (- strand) : 108 bp

chr11:1627705..1627749 (- strand) : 45 bp

chr11:1627509..1627597 (- strand) : 89 bp

chr11:1627001..1627044 (- strand) : 44 bp

chr11:1626739..1626836 (- strand) : 98 bp

3'UTR

chr11:1626506..1626738 (- strand) : 233 bp

FASTA

>Os11t0135000-02 class=Sequence position=chr11:1626506..1630253 (- strand)
AATTTTTAAC TCGTCTTCGA ATCTATACTT TCAGCATTGT GCTCAATACT TTGTTTGGAT TAAGTGTGAA GTACTGGATG
GCTGTTACCA CGAGATTCCT TCTTGGTGCT CTGAATGGAT TGCTTGCACC AATAAAGGTA CCTTTTTAGG AAACATTAAG
ATACTTTGAA ATGTGAAAGA AGTCTGTTGA GAACAAATAA GGGATGGTGT CAGTATCAAT TGGTATTCTT ATTCCATCAA
CAATCTACTT AATTATGTTT TATATTACTT GTGGCTGCAG GCTTACTCTA TCGAAGTTTG CCGAGCTGAA CATCAAGCTC
TGGGCCTATC AATTGTAAAA TACAAATCTA TATATAGCAC TTCACATCTA TATATATGAT GGCATAACTT TGTTTCATGT
CATGGACTAA GTTTCATCCA TGTCATCAAA ATTTTAGGTG AGCACAGCAT GGGGAATAGG TCTTGTAGTT GGTCCAGCAA
TTGGAGGCTA CCTCGCGCAG GTAATATTAG ATAAGCATAT TCGGGTTCAT AAATATCCTT TTCTTCTTTT GTGAATGATC
GATGACAATG AGTATTTATC TTTACCTTGG TCTATTTCTT GATATCAGCC TGTCAAACAA TATCCTCATC TTTTTCATGA
AAAGTCAATA TTTGGGAGGT ATTTTTCCTA TTGAAAACCG GTTCTTCAGA TTTAATGAGA AATATTATGC AATTGTAAAT
GTGTGATTGC AAATTGTGCA GATTTCCATA CCTTCTACCC TGTCTTTGTA TATCACTTTT TGCTCTCTTG GTCCTCATAA
GCTGTATATG GCTACCGGTA TGTATTACTA TTTGTTAAGT TGCATTATTA AGATTATATA TTCTATTTCC ATGATTCCAA
CTGCAAGAAT TTTGTGTATC TCTTTTATGA TCAGTTTCTA AATAAGACTG CCTTGTTGGA TAACCAAAAG AACCAAGACA
GATACCCAAA CTAACCGCAT GAACCATGTG CCTGACTGCC TGGTCTACCA ACCCTTTGTA AACCTTGCGC ATGACTTAAT
CTCTATTATC ATTTTTTATG ACTGCATATT TCTTTGATCA ACTAAATAGG AGACCCTACA TAAGCATAAA GGCCTTGAAA
CAGGAGTGGA GGCAGCTGAA GCTTCTACTA CTCAAGGAAG TGCAGAATCA CATAAGAAAA GTTTATTCAG AAATTGGCCA
TTGATGTCAT CTATCATCAC ATATTGTGTC TTCTCCCTTC ACGACACCGC ATATAGCGAG GTAGTAACAG TTATTAATGT
GATATGAAAT TGTTATTATG TAACCTCTCT ATGTCAAATA ATTATCTTGC CTTTCTCCAT AAAGAGCATG TTTCTTGCTC
TATAAATAAG CTGACAATGC ATTTGCGGTA ATAAACCTTT CATATTTATC CATGGCAATA TTTTTCTTTC AGTTAATCAT
ATATCTCTAA GTTATGTGTT GTCATACCCA AGTATTAGCA AATTCTTCCA TTTTAGTCTA TGAATATTGA TCTATCAAAA
ATCAAATATG CTATGTGAAA AATGTAATTT TCTAAACATT ATTTTTTTta acatcagata ttttctctgt ggactgtaag
tgatagaaaa tatggtggac tcagcttttc atctaaagat gttgggcaag ttcttgcagt ggcaggtaaG TCAAATTCAA
TCAATTTCTT TCCTACAAAT TTTAAACATA GGAAACTCTT TAATCACAGG GTGTTTGCAT TAATGTTGAG CTGTGACATG
TTGGTTTGGA AAGGTGAACA TGTTTTTGTT ACACTGTAGG TGCCAGCCTT CTTGTATATC AACTTTTTAT CTACCGTTGG
GTTGATAAAA TTCTTGGACC TATCAACTCA ACCCGCATTG CGTCGGTGAG TTACTAATTT CAATGTTTCA TAGTTTCTCA
TATACTTGGT ACAGTTTACT TATTATTGGT TACCGAGAGG TTTAAGAGAA AAGAGTTCAA AGAATTATTG GTTAATGCCT
GCTTTTATCA GCTGACCTTT AGCATTGCAG GTACTATCTA TACCGATTAT TGCTGCTTAT CCCTTTATGA CGCACTTATC
AGGAATAAGA CTTGGTGTGG CCCTCTATAG TGCAGCAATG ATCAAAAGTG TTCTTGCTGT AAGTACTTTA TGAACCTATG
ATTTATATTT TTAAAAAAAA ATAATTCTAA AAGTATAAAC TCTCATATAT ATTTTTTAGT AAACCTGTTG GCTACTCCAC
TCAAGGAAGC ATGGTAAACA AATACTTAGC AAAGGCATTA TTGCACCTTT GGTCGTGGAG CCTGTGGGTG GTCTGACCAA
AAGGTTCAGA TGTGAAAATA AAAAAAATGT TAATATTTAA AAAAGTGGTT GAAAAATCCA CGAGCTTGCA GTTCTGAAAT
TTAGCTAGCA CTTCAACTGC ACAAAGTTAT ATGCTAAAAT GTATGCTAGG TAATTTAGTT TATTTGCACA TTTGAAGATA
CTAATATTTC GTAATGTTGA TCAGATAACT ATAATTACGG GCACTTCTCT TCTACAAAAC AAAGCAGTGG TACTTGTCCC
ACTTATCTGA TCTCACTTGA CTATTGTCTG ACAGCCTCAC AAAAGAAAAG AAATTTTTCT GACATTTTTT TTTTGAAAAA
TGCATTATTT TGACAGCCAC AAGGGCAACG GGGTGCTGCA AACGGAATAG CTACAACGGC CATGTCCTTG TTCAAGGCTG
TTGCACCAGC TGGCGCAGGT GTTCTGTAAG TACAAATCTA ATTGTCTACA ACTCTTGATT ATAAACTAAC AGTTGAACAG
AACTACTAGA TATATGGACA ACATTTTTTA GAAAATGGAT TAAACTGGCC TCTACATCCA AAATACATGT ACACGGCAAA
AGATATATGG ACAACATAAT TGTCGCTTTT CACAAATACT ACAGGAGTAT GACCATCAGT GGTGTTTACC ATTTGGGCTG
TGTACATCCA TTGTGGATGT AGAGGCCGGA TTTTAATCCA TTTTCTAAAA AAAAAAGTGG TACTTACCAT TTGTTTGACA
CAAACTGTGG TCATGAAAAA TGTTAGTGGC TAGTTTGTCC TTCCAAGTTT AGTGAATAGT TGTTGCCTGA AGCCTGAAGA
TAGATATGAA AGGATGAGCC TGTTCTAACA GAACTGTAAA CCTGTTTTGA AGAAGAAAAG GACTGACTGT TGAAAATCTG
TGGCTGCAGA TTCTCTTGGG CACAAAAGCG ACAGCATGCA GCATTTTTTC CAGGTAAATA CTCCTATGCA TTTTTATGAA
CCATGTTGCA GCCATTACTA CAGTACTTTA TATAAGTGAA GTAAACAAAT CGGTGTTGTG AATTACTAGC ACATACAAGA
AATAGAAACT TGTGTTATGT TGATTTGATC ATAAAATGGA AATTCAATGT TGTGCAGGTG ATCAGATGGT GTTTCTTTTA
CTGAACCTGA CTGAGGTCAT TGGACTCATG TTGACCTTCA AACCTTTCTT GGCGGTTCCT CAACAATACA AATAGAACAT
TCAGATACTG TCAGCTGGTG TGGCAAACAC CATAGAGAGA TAGTTGTAGC TAGTACTATG TTTTAGTATT AAAACATGGT
TTAGATATGG TTGTAGCAGA GTGTTAGAAA CATGCACCAT TCCAGGTGCA GAGCCTCTGT TAGGTTGTTC TTCTTTTTGT
TCTGCTTTGG GTCTGTGAGA TAAATAATCT TGCAAAAGCT ATGACATTTT TTATTGCAGC TTTGGAGT

Locus: Os11g0135000

Loading...

Locus: Os11g0135000

Loading...