Os11t0146800-01

Locus

Os11g0146800

Description

Meiosis-specific DNA recombinase, Synaptonemal complex (SC) assembly

RAP-DB Gene Symbol Synonym(s)

RILIM15B, DMC1B, RiLIM15B, OsDMC1B, OsDmc1B, Dmc1B

RAP-DB Gene Name Synonym(s)

RILIM15B GENE, MEIOTIC PROTEIN DMC1B, RiLIM15B protein, MEIOTIC PROTEIN Dmc1B

CGSNL Gene Symbol

DMC1B

CGSNL Gene Name

MEIOTIC PROTEIN DMC1B

Oryzabase Gene Symbol Synonym(s)

OsDMC1B, OsDmc1B, Dmc1B, RiLIM15B

Oryzabase Gene Name Synonym(s)

MEIOTIC PROTEIN Dmc1B

Transcript Evidence

AB079874

Protein Evidence

Q7GBF7

Literature

PMID: 26960731

PMID: 18583359

Note

Manual Curation

May 16, 2016

Gene Ontology (GO)

Biological Process: DNA metabolic process (GO:0006259)

Biological Process: DNA repair (GO:0006281)

Biological Process: reciprocal meiotic recombination (GO:0007131)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: DNA-dependent ATPase activity (GO:0008094)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

DNA recombination and repair protein, RecA-like (IPR016467)

Meiotic recombinase Dmc1 (IPR011940)

DNA repair Rad51/transcription factor NusA, alpha-helical (IPR010995)

DNA recombination and repair protein Rad51, C-terminal (IPR013632)

DNA recombination and repair protein RecA-like, ATP-binding domain (IPR020588)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

DNA recombination and repair protein RecA, monomer-monomer interface (IPR020587)

Expression Databases

TENOR (Os11t0146800-00)

Others

Oryzabase (8508)

Transcript

1454 bp

>Os11t0146800-01 Meiosis-specific DNA recombinase, Synaptonemal complex (SC) assembly
AACGCAACGGCACAAGCACAACACCACTTCGAGTGTGTTTGTCGTCTCGCCTCTGCTGCT
TCCTTCTCCTACAAGCCGCCGCTCCGACCTCGCCGTCGCCGGTCGCCGGCCGCCTCCGCC
TACAGGTGCGGGGGGTCTGTGTGAGCAGATGGCGCCGTCCAAGCAGTACGACGAAGGCGG
GCAGCTCCAGCTCATGGATGCAGAGAGGATCGAGGAGGAGGAGGAGTGCTTCGAGTCCAT
CGACAAGTTAATCTCGCAAGGGATAAACTCTGGAGATGTGAAGAAGCTGCAGGATGCTGG
TATCTACACTTGCAATGGCCTCATGATGCATACAAAGAAGAGCCTGACAGGAATCAAGGG
ATTATCTGAAGCAAAGGTAGACAAGATCTGTGAAGCAGCTGAAAAGCTTCTGAGCCAGGG
CTTCATGACAGGAAGTGATCTCCTTATCAAGcggaagtctgttgttcggatcaccactgg
gagccaggcacttgatgagctgcttggcggagggattgaaacactctgcatcacagaggc
atttggagagttccgATCAGGGAAGACCCAGTTGGCTCACACTCTATGTGTCTCCACTCA
GCTTCCAATTCACATGCATGGGGGGAACGGGAAGGTTGCTTACATTGACACTGAGGGAAC
ATTCCGGCCTGAACGAATTGTGCCAATTGCTGAGAGATTTGGGATGGATGCCAATGCTGT
TCTTGATAACATCATATATGCTCGTGCATACACCTATGAGCACCAGTACAACTTGCTCCT
TGGCCTCGCTGCCAAGATGGCTGAAGAGCCTTTCAGGCTTCTGATTGTGGATTCTGTGAT
TGCACTATTCCGTGTTGATTTCAGTGGCAGGGGTGAACTTGCAGAGCGCCAGCAAAAATT
GGCACAGATGCTCTCCCGCCTTACTAAGATAGCTGAGGAGTTCAATGTTGCAGTGTACAT
CACCAACCAAGTGATTGCGGACCCAGGTGGTGGAATGTTCATAACTGACCCGAAGAAACC
TGCGGGAGGCCACGTTCTGGCGCATGCAGCCACCATCCGGTTGATGCTGAGGAAAGGCAA
AGGAGAGCAGCGTGTCTGCAAGATCTTTGATGCCCCTAACCTGCCTGAGGGAGAAGCTGT
TTTCCAGGTAACATCAGGTGGAATAATGGATGCGAAAGACTGAATGTTCACTGAGGGTGC
TTCCTGTGTTCAAATTGTTCAGGTTTCTCCAAGTAAATTTCTGCATAGGCCATATAGGTT
AGGTACATTGATAAAAGAATACAACTACTGCTGCTGCTATGTTTTTGCCACTGCTGAGGA
AAGAGGCAACCTCATTTATCAAGACGGTTATATCTCACATTGGGTATTATGAGTTATGTG
ATCAACAGTTGTACTGAAACAAGTGCTAGTATTGTCTTAAGTGAAAATATAAGAGGTTAA
CATGTTGGTTTCCC

CDS

1035 bp

>Os11t0146800-01 Meiosis-specific DNA recombinase, Synaptonemal complex (SC) assembly
ATGGCGCCGTCCAAGCAGTACGACGAAGGCGGGCAGCTCCAGCTCATGGATGCAGAGAGG
ATCGAGGAGGAGGAGGAGTGCTTCGAGTCCATCGACAAGTTAATCTCGCAAGGGATAAAC
TCTGGAGATGTGAAGAAGCTGCAGGATGCTGGTATCTACACTTGCAATGGCCTCATGATG
CATACAAAGAAGAGCCTGACAGGAATCAAGGGATTATCTGAAGCAAAGGTAGACAAGATC
TGTGAAGCAGCTGAAAAGCTTCTGAGCCAGGGCTTCATGACAGGAAGTGATCTCCTTATC
AAGcggaagtctgttgttcggatcaccactgggagccaggcacttgatgagctgcttggc
ggagggattgaaacactctgcatcacagaggcatttggagagttccgATCAGGGAAGACC
CAGTTGGCTCACACTCTATGTGTCTCCACTCAGCTTCCAATTCACATGCATGGGGGGAAC
GGGAAGGTTGCTTACATTGACACTGAGGGAACATTCCGGCCTGAACGAATTGTGCCAATT
GCTGAGAGATTTGGGATGGATGCCAATGCTGTTCTTGATAACATCATATATGCTCGTGCA
TACACCTATGAGCACCAGTACAACTTGCTCCTTGGCCTCGCTGCCAAGATGGCTGAAGAG
CCTTTCAGGCTTCTGATTGTGGATTCTGTGATTGCACTATTCCGTGTTGATTTCAGTGGC
AGGGGTGAACTTGCAGAGCGCCAGCAAAAATTGGCACAGATGCTCTCCCGCCTTACTAAG
ATAGCTGAGGAGTTCAATGTTGCAGTGTACATCACCAACCAAGTGATTGCGGACCCAGGT
GGTGGAATGTTCATAACTGACCCGAAGAAACCTGCGGGAGGCCACGTTCTGGCGCATGCA
GCCACCATCCGGTTGATGCTGAGGAAAGGCAAAGGAGAGCAGCGTGTCTGCAAGATCTTT
GATGCCCCTAACCTGCCTGAGGGAGAAGCTGTTTTCCAGGTAACATCAGGTGGAATAATG
GATGCGAAAGACTGA

Protein

345 aa

>Os11t0146800-01 Meiosis-specific DNA recombinase, Synaptonemal complex (SC) assembly
MAPSKQYDEGGQLQLMDAERIEEEEECFESIDKLISQGINSGDVKKLQDAGIYTCNGLMM
HTKKSLTGIKGLSEAKVDKICEAAEKLLSQGFMTGSDLLIKRKSVVRITTGSQALDELLG
GGIETLCITEAFGEFRSGKTQLAHTLCVSTQLPIHMHGGNGKVAYIDTEGTFRPERIVPI
AERFGMDANAVLDNIIYARAYTYEHQYNLLLGLAAKMAEEPFRLLIVDSVIALFRVDFSG
RGELAERQQKLAQMLSRLTKIAEEFNVAVYITNQVIADPGGGMFITDPKKPAGGHVLAHA
ATIRLMLRKGKGEQRVCKIFDAPNLPEGEAVFQVTSGGIMDAKD*

5'UTR

chr11:2124287..2124411 (- strand) : 125 bp

chr11:2124160..2124182 (- strand) : 23 bp

CDS

chr11:2124060..2124159 (- strand) : 100 bp

chr11:2123166..2123257 (- strand) : 92 bp

chr11:2122948..2123019 (- strand) : 72 bp

chr11:2122813..2122851 (- strand) : 39 bp

chr11:2122590..2122647 (- strand) : 58 bp

chr11:2122459..2122504 (- strand) : 46 bp

chr11:2121813..2121858 (- strand) : 46 bp

chr11:2121662..2121723 (- strand) : 62 bp

chr11:2121489..2121555 (- strand) : 67 bp

chr11:2121315..2121407 (- strand) : 93 bp

chr11:2121161..2121229 (- strand) : 69 bp

chr11:2120984..2121062 (- strand) : 79 bp

chr11:2120734..2120900 (- strand) : 167 bp

chr11:2120438..2120482 (- strand) : 45 bp

3'UTR

chr11:2120167..2120437 (- strand) : 271 bp

FASTA

>Os11t0146800-01 class=Sequence position=chr11:2120167..2124411 (- strand)
AACGCAACGG CACAAGCACA ACACCACTTC GAGTGTGTTT GTCGTCTCGC CTCTGCTGCT TCCTTCTCCT ACAAGCCGCC
GCTCCGACCT CGCCGTCGCC GGTCGCCGGC CGCCTCCGCC TACAGGTGAG GAAGGTTCTC TCCGCCGCAG CGGCCTCCGC
TCGACGTCTT TGCTAGGGTT TTGGGGTGAT TTTTCGGTTG GGTTGTCTCC TGATCGCATT TTGACGCAGG TGCGGGGGGT
CTGTGTGAGC AGATGGCGCC GTCCAAGCAG TACGACGAAG GCGGGCAGCT CCAGCTCATG GATGCAGAGA GGATCGAGGA
GGAGGAGGAG TGCTTCGAGT CCATCGACAA GTGTATGTAA CGCCCTCCGC CTCATTTCCA TCCCCTCCTC CCCCGTCTCG
TATCCCGGCA CTGCATTGCT TGGCTCGTGC TCGTGTGCGC GTGTGTGTTC GCGCGTGCGA GTGCTCATTC TGCCTTGCGT
TTCGATTGGT TACTCTTCAC ATTGTAATTT GATGCTGATT TGCGGTGAAG TAGATGGATT CTAGCCTATT TTGTGTTTCC
ATTTTTTTTT GGGGTCTGGT TGTTTTGTGC TGTGCGTGTT CGGTTGCTTC TAGTTTTTCT CCCTCAATTT CGTGTGTTCT
GGACGTAAAT TAGCCTCGTA TCGTGGCCAA TTTTTTCGGG ATTTTTCGCC TCCCCACATT TGATATCTGT TTTGGGCTAT
TTCCTGCTGA TCGATGTGTG GCATGTGAGA GGGCTGGTTC GAATTTATCC CCATTTTCAG TCAATTTTAC CCGCGTTTGG
TGGAACTCGT CGGAATTCGC CCCCGGCTAG TTCAAACATG TGGGGTTCTG CCCATTAGTT GAACCAGTTG TGTTTTGGTG
AACTTGAGTG TATATTAGTT GAACCAGTTG TGTACTTGGA GGGTTTAGGG TTTAAGCTTG AGTCCCTCTT GTACTTTTAC
GATTTCTGGT GGCTCCCTAA TTCTAGCGAG TTCAATATTA GTAAGTTGTT TTGGTGTGAT CCTGACTTCT CCCTGGGTTT
CATTCTTCAT ATGGTTCTTC CTGCAAATTA TTCATTCATA TCCATGAATT CGAACTATGA GCAATTGAGC ATAATCTCTG
CATTATTATC CATCTCTCGT GCACTTGTCC ACAGTAATCT CGCAAGGGAT AAACTCTGGA GATGTGAAGA AGCTGCAGGA
TGCTGGTATC TACACTTGCA ATGGCCTCAT GATGCATACA AAGAAGGTTG CAAAATTGGG TTCCCAAATC TTCATGCTAT
CTCCCACTTG TTCTATTTCT GGTTTATGAC GATTATATTC TTTCAATTGT CCCATTTCTG TCTTACAATA TAATTATCTG
ATATTGTTTC AATATATGGA TCCATCTTGT AGAGCCTGAC AGGAATCAAG GGATTATCTG AAGCAAAGGT AGACAAGATC
TGTGAAGCAG CTGAAAAGCT TCTGGTGTGG TTCTCTTTTC ATTGTTTTTG GTCTGAAATC TTCATTACGT CAGTTCTGTA
TGATTTGTTC TTCTGAAACT GCTATGTTTG TTTTTCTCAG AGCCAGGGCT TCATGACAGG AAGTGATCTC CTTATCAAGG
TAAGTTAATA GGAGCTGATC TGCGTACTAA TGCATTTAAG GATATGGTGT TATGGCAAAT AAGTGGAAAC TATTCCTTGC
TTCATGGACG CTAGAGTGCt tttagttact ccagctgtgc actttcccta ggctgttcgg tttattattt ttcttatttt
gaagcggaag tctgttgttc ggatcaccac tgggagccag gcacttgatg agctgcttgg cggtaacata tatagtcctc
tgactctgtt atgatcagtt gttccattat gttgttctaa tctacttaca tttttcaatt tttcaaggag ggattgaaac
actctgcatc acagaggcat ttggagagtt ccggtgcgta gatgttcatg ttccttttga tattttttgc cctcGTTTAC
AACTGCAGCT TGGTTGTATC AATGAAATTT ATGATGTGTG GCCATACCTG TCTAATAAAT ATGGTGAAAT CAAGCTTACT
AATACTATTA GTATTCTGGT TTAAGTTAAT TTGCTAGTGC CTTTTCAAAC CTGTTGTGCA CCCATTTCTA TCGTCTATTC
ATGCCAGTGC ATACAGCAAT TCCTAAACAT GTTCTGTGTT CTGCTAAAAC TGAGAGCTTA ATACTGTACT TCTCATTTGT
AAACTTCAGG TATATACACA TCAATATTGT CAAACTATTT CCTTTGATGT TATACCAAAT TGGTTCTACT AAACATTACA
TTTAGCTGAT TTATCTTGTT TTGCAACAAA TTTGATGTAT GATAGAGTTC TTCCTAGAAT TGTATCGCGT GGAACAATTT
GGATTTCTGT AGCACATAAA ACATCTTACT ATTTAATTTT AATGTGAGCC AGCCAAACTT TGAACCTTGA TGTGCTCTGG
AGTTAGTTTT CACTATTTCT CAATTTGGTT CCGGCTTCCT AGCTTTGTAA TCTTTCACTT TTTTGGTCCT CAGATCAGGG
AAGACCCAGT TGGCTCACAC TCTATGTGTC TCCACTCAGG TTCATTTTTA ATACATGTTT TTGTCATCAC CACCTTACTG
CCATAGATTC AGTGAATTAT TTTCTTTTTT TTTGTTCATA AACTGCAGCT TCCAATTCAC ATGCATGGGG GGAACGGGAA
GGTTGCTTAC ATTGACACTG AGGGAACATT GTATCTTTTG AATTTACTTA GCAATAGCTT CATCTGATCC ATCCATTCAA
TGGATTTATT TGCATTTCTG TATCTCTCCA ACTTGTTTCC TTAATGGAGT TTTCAGCCGG CCTGAACGAA TTGTGCCAAT
TGCTGAGAGA TTTGGGATGG ATGCCAATGC TGTTCTTGAT AACGTATGGC CCTTAATTTG ACTTTACCAT TTCAGGCCTA
ACAAAAGAAG CTATCTGTTA TATTTGCATC TATTTCTTGT TTAGATCATA TATGCTCGTG CATACACCTA TGAGCACCAG
TACAACTTGC TCCTTGGCCT CGCTGCCAAG ATGGCTGAAG AGCCTTTCAG GCTTCTGGTA GGCATGGCTT AACATAAAAA
TACATTGATA AGTTTGTGTA TCTCAATCTC TTATGTGGTA GTATTGTTTT ACCTGGAATT AGATTGTGGA TTCTGTGATT
GCACTATTCC GTGTTGATTT CAGTGGCAGG GGTGAACTTG CAGAGCGCCA GGTATTGCCA ATATTTGTGT TGGCTAAAAC
ACACACAAAT AAATAATCAT AAAGTAGTTG AAGGCCTAAA GTTATGTACT AATTACTCTG AACTTGCAGC AAAAATTGGC
ACAGATGCTC TCCCGCCTTA CTAAGATAGC TGAGGAGTTC AATGTTGCAG TGTACATCAC CAACCAAGGT GTGCTTTCAG
GACTAATCCT GTCTATCCCA AGAAAGAGTA ACTCAATAAG GAATTTCAAA TTACAAGTGT CTTTGTTTCA GTGATTGCGG
ACCCAGGTGG TGGAATGTTC ATAACTGACC CGAAGAAACC TGCGGGAGGC CACGTTCTGG CGCATGCAGC CACCATCCGG
TTGATGCTGA GGAAAGGCAA AGGAGAGCAG CGTGTCTGCA AGATCTTTGA TGCCCCTAAC CTGCCTGAGG GAGAAGCTAT
ATCCTTTTGC ATTGTGCATA CATGTTTACT GAAACTACTT GTTCAATTGG TTACCTTGGT TCAGTATGCT GCTAAAATAT
TGATTGATTT TTTCTTTGTC CGAACTTTCT CCTCAAAACT CTTGCAGCTG CTGTTTTTCC CATCTGAAAA AAAAACCTGT
TGTTTTCCAT CACTGAAACT CTGAAGCTTC GCATGACAGA TTAGCAATAA TGTGGTGTAA AAAAAATTGT TTCCCTTGAC
CAATAGCACG TTTTCCAGGT AACATCAGGT GGAATAATGG ATGCGAAAGA CTGAATGTTC ACTGAGGGTG CTTCCTGTGT
TCAAATTGTT CAGGTTTCTC CAAGTAAATT TCTGCATAGG CCATATAGGT TAGGTACATT GATAAAAGAA TACAACTACT
GCTGCTGCTA TGTTTTTGCC ACTGCTGAGG AAAGAGGCAA CCTCATTTAT CAAGACGGTT ATATCTCACA TTGGGTATTA
TGAGTTATGT GATCAACAGT TGTACTGAAA CAAGTGCTAG TATTGTCTTA AGTGAAAATA TAAGAGGTTA ACATGTTGGT
TTCCC

Locus: Os11g0146800

Loading...

Locus: Os11g0146800

Loading...