Os11t0149400-01

Locus

Os11g0149400

Description

Similar to Phytosulfokines 2 precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSK2

CGSNL Gene Name

PHYTOSULFOKINE 2

Oryzabase Gene Symbol Synonym(s)

OsPSK2

Oryzabase Gene Name Synonym(s)

phytosulfokine 2

Transcript Evidence

AK063900 (DDBJ, Best hit)

Protein Evidence

Q0IUL4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell proliferation (GO:0008283)

Cellular Component: extracellular region (GO:0005576)

Molecular Function: growth factor activity (GO:0008083)

Functional domain (InterPro)

Phytosulfokine (IPR009438)

Full-length cDNA

001-122-H04 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0149400-01)

RiceXPro (AK063900)

Others

Oryzabase (14418)

KEGG (Os11t0149400-01)

Transcript

866 bp

>Os11t0149400-01 Similar to Phytosulfokines 2 precursor.
ACCCAAACCCAAAGCAGCAATTGCAAGAAGCAAAATCTCTTCTCCTCCTCCTCCTCCTCC
TCATCATCATCCTCCTCTCGCCCTTCGACAACGCACCATAGTTTAACCCAAGCTAGAAGA
AGAAGACGATAGATATGAGCACTACTCGCGGCGTCTCCTCCTCTTCTGCTGCTGCTGCTC
TTGCGCTGCTTCTCCTCTTCGCCCTCTGCTTCTTCTCCTTCCACTTCGCCGCAGCTGCTC
GCGCCGTTCCTCGTGATGAACACCAAGAGAATGGCGGTGTCAAGGCAGTAGCAGCAGTTG
CAGCTGATCAGCTTGTGCTCCAGCTGGAAGGTGACACCGGCAATGGCGACGAGGTCTCCG
AGTTGATGGGAGCAGCTGAGGAGGAAGCAGCAGCATGCGAGGAGGGGAAGAACAACGACG
AGTGCGTGCAGAGGAGGCTGCTCAGCGACGCCCACCTCGACTACATCTACACGCAGCACA
AGAACAAGCCTTGATCGATCGATCCATCCATCCAACTACACGCTGAAATCCAAAGCTAAT
ACAAGGAAGATCGAGATCGAGATAAATTAACCAACTCTATATGCATATCTATCTATCCAT
CTACCTCTGCATGCTGTTTTCACTGCATCGATCGCTACTGTTCTGCAGTGCCAATCACTG
TCCGTTTCTGTACAATCTGTGATACTACTAGCTAGTAGCAGTACATGGCATCGTTTTCCT
TCAAGTGTTCGTTGGCTTTTACTTAGTCCGGTGAGTGCTTGTGGGTTATTTCTGACGAGG
GAGTGTGATCAGTACGCGTACTAATGGTATTTTGGTTTGTCATGGCATGATGAAATTAAG
CTGTGGTAGCAATATAATGCATATAT

CDS

360 bp

>Os11t0149400-01 Similar to Phytosulfokines 2 precursor.
ATGAGCACTACTCGCGGCGTCTCCTCCTCTTCTGCTGCTGCTGCTCTTGCGCTGCTTCTC
CTCTTCGCCCTCTGCTTCTTCTCCTTCCACTTCGCCGCAGCTGCTCGCGCCGTTCCTCGT
GATGAACACCAAGAGAATGGCGGTGTCAAGGCAGTAGCAGCAGTTGCAGCTGATCAGCTT
GTGCTCCAGCTGGAAGGTGACACCGGCAATGGCGACGAGGTCTCCGAGTTGATGGGAGCA
GCTGAGGAGGAAGCAGCAGCATGCGAGGAGGGGAAGAACAACGACGAGTGCGTGCAGAGG
AGGCTGCTCAGCGACGCCCACCTCGACTACATCTACACGCAGCACAAGAACAAGCCTTGA

Protein

120 aa

>Os11t0149400-01 Similar to Phytosulfokines 2 precursor.
MSTTRGVSSSSAAAALALLLLFALCFFSFHFAAAARAVPRDEHQENGGVKAVAAVAADQL
VLQLEGDTGNGDEVSELMGAAEEEAAACEEGKNNDECVQRRLLSDAHLDYIYTQHKNKP*

5'UTR

chr11:2291329..2291462 (+ strand) : 134 bp

CDS

chr11:2291463..2291595 (+ strand) : 133 bp

chr11:2291681..2291775 (+ strand) : 95 bp

chr11:2291907..2292038 (+ strand) : 132 bp

3'UTR

chr11:2292039..2292410 (+ strand) : 372 bp

FASTA

>Os11t0149400-01 class=Sequence position=chr11:2291329..2292410 (+ strand)
ACCCAAACCC AAAGCAGCAA TTGCAAGAAG CAAAATCTCT TCTCCTCCTC CTCCTCCTCC TCATCATCAT CCTCCTCTCG
CCCTTCGACA ACGCACCATA GTTTAACCCA AGCTAGAAGA AGAAGACGAT AGATATGAGC ACTACTCGCG GCGTCTCCTC
CTCTTCTGCT GCTGCTGCTC TTGCGCTGCT TCTCCTCTTC GCCCTCTGCT TCTTCTCCTT CCACTTCGCC GCAGCTGCTC
GCGCCGTTCC TCGTGATGAA CACCAAGGTA GCTAGCTACA GCACTTGGAT TATTGATTGT TCAATTGATA GTGTATGCAA
ATTAGCTGAC GTTTTGGAGC TTTTCTTTTC AGAGAATGGC GGTGTCAAGG CAGTAGCAGC AGTTGCAGCT GATCAGCTTG
TGCTCCAGCT GGAAGGTGAC ACCGGCAATG GCGACGAGGT CTCCGAGGTG AGAATCGATG GAAATATACA GAGCTATAAA
TCTTCGAGTA CCTAGCTGAT TAGACAAGAA TTGATGAAGA AGCAATTAGT GGTAACTAAT CTTGATTGTT AATTTATTTC
TATCTTGTTC TTGGTCAGTT GATGGGAGCA GCTGAGGAGG AAGCAGCAGC ATGCGAGGAG GGGAAGAACA ACGACGAGTG
CGTGCAGAGG AGGCTGCTCA GCGACGCCCA CCTCGACTAC ATCTACACGC AGCACAAGAA CAAGCCTTGA TCGATCGATC
CATCCATCCA ACTACACGCT GAAATCCAAA GCTAATACAA GGAAGATCGA GATCGAGATA AATTAACCAA CTCTATATGC
ATATCTATCT ATCCATCTAC CTCTGCATGC TGTTTTCACT GCATCGATCG CTACTGTTCT GCAGTGCCAA TCACTGTCCG
TTTCTGTACA ATCTGTGATA CTACTAGCTA GTAGCAGTAC ATGGCATCGT TTTCCTTCAA GTGTTCGTTG GCTTTTACTT
AGTCCGGTGA GTGCTTGTGG GTTATTTCTG ACGAGGGAGT GTGATCAGTA CGCGTACTAA TGGTATTTTG GTTTGTCATG
GCATGATGAA ATTAAGCTGT GGTAGCAATA TAATGCATAT AT

Locus: Os11g0149400

Loading...

Locus: Os11g0149400

Loading...