Os11t0149400-02

Locus

Os11g0149400

Description

Similar to cDNA clone:001-122-H04, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSK2

CGSNL Gene Name

PHYTOSULFOKINE 2

Oryzabase Gene Symbol Synonym(s)

OsPSK2

Oryzabase Gene Name Synonym(s)

phytosulfokine 2

Transcript Evidence

AK073352 (DDBJ, Best hit)

Protein Evidence

B7E958 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J033027C09 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0149400-02)

Others

Oryzabase (14418)

Transcript

1082 bp

>Os11t0149400-02 Similar to cDNA clone:001-122-H04, full insert sequence.
ACCCAAACCCAAAGCAGCAATTGCAAGAAGCAAAATCTCTTCTCCTCCTCCTCCTCCTCC
TCATCATCATCCTCCTCTCGCCCTTCGACAACGCACCATAGTTTAACCCAAGCTAGAAGA
AGAAGACGATAGATATGAGCACTACTCGCGGCGTCTCCTCCTCTTCTGCTGCTGCTGCTC
TTGCGCTGCTTCTCCTCTTCGCCCTCTGCTTCTTCTCCTTCCACTTCGCCGCAGCTGCTC
GCGCCGTTCCTCGTGATGAACACCAAGGTAGCTAGCTACAGCACTTGGATTATTGATTGT
TCAATTGATAGTGTATGCAAATTAGCTGACGTTTTGGAGCTTTTCTTTTCAGAGAATGGC
GGTGTCAAGGCAGTAGCAGCAGTTGCAGCTGATCAGCTTGTGCTCCAGCTGGAAGGTGAC
ACCGGCAATGGCGACGAGGTCTCCGAGGTGAGAATCGATGGAAATATACAGAGCTATAAA
TCTTCGAGTACCTAGCTGATTAGACAAGAATTGATGAAGAAGCAATTAGTGGTAACTAAT
CTTGATTGTTAATTTATTTCTATCTTGTTCTTGGTCAGTTGATGGGAGCAGCTGAGGAGG
AAGCAGCAGCATGCGAGGAGGGGAAGAACAACGACGAGTGCGTGCAGAGGAGGCTGCTCA
GCGACGCCCACCTCGACTACATCTACACGCAGCACAAGAACAAGCCTTGATCGATCGATC
CATCCATCCAACTACACGCTGAAATCCAAAGCTAATACAAGGAAGATCGAGATCGAGATA
AATTAACCAACTCTATATGCATATCTATCTATCCATCTACCTCTGCATGCTGTTTTCACT
GCATCGATCGCTACTGTTCTGCAGTGCCAATCACTGTCCGTTTCTGTACAATCTGTGATA
CTACTAGCTAGTAGCAGTACATGGCATCGTTTTCCTTCAAGTGTTCGTTGGCTTTTACTT
AGTCCGGTGAGTGCTTGTGGGTTATTTCTGACGAGGGAGTGTGATCAGTACGCGTACTAA
TGGTATTTTGGTTTGTCATGGCATGATGAAATTAAGCTGTGGTAGCAATATAATGCATAT
AT

CDS

240 bp

>Os11t0149400-02 Similar to cDNA clone:001-122-H04, full insert sequence.
ATGAACACCAAGGTAGCTAGCTACAGCACTTGGATTATTGATTGTTCAATTGATAGTGTA
TGCAAATTAGCTGACGTTTTGGAGCTTTTCTTTTCAGAGAATGGCGGTGTCAAGGCAGTA
GCAGCAGTTGCAGCTGATCAGCTTGTGCTCCAGCTGGAAGGTGACACCGGCAATGGCGAC
GAGGTCTCCGAGGTGAGAATCGATGGAAATATACAGAGCTATAAATCTTCGAGTACCTAG

Protein

80 aa

>Os11t0149400-02 Similar to cDNA clone:001-122-H04, full insert sequence.
MNTKVASYSTWIIDCSIDSVCKLADVLELFFSENGGVKAVAAVAADQLVLQLEGDTGNGD
EVSEVRIDGNIQSYKSSST*

5'UTR

chr11:2291329..2291583 (+ strand) : 255 bp

CDS

chr11:2291584..2291823 (+ strand) : 240 bp

3'UTR

chr11:2291824..2292410 (+ strand) : 587 bp

FASTA

>Os11t0149400-02 class=Sequence position=chr11:2291329..2292410 (+ strand)
ACCCAAACCC AAAGCAGCAA TTGCAAGAAG CAAAATCTCT TCTCCTCCTC CTCCTCCTCC TCATCATCAT CCTCCTCTCG
CCCTTCGACA ACGCACCATA GTTTAACCCA AGCTAGAAGA AGAAGACGAT AGATATGAGC ACTACTCGCG GCGTCTCCTC
CTCTTCTGCT GCTGCTGCTC TTGCGCTGCT TCTCCTCTTC GCCCTCTGCT TCTTCTCCTT CCACTTCGCC GCAGCTGCTC
GCGCCGTTCC TCGTGATGAA CACCAAGGTA GCTAGCTACA GCACTTGGAT TATTGATTGT TCAATTGATA GTGTATGCAA
ATTAGCTGAC GTTTTGGAGC TTTTCTTTTC AGAGAATGGC GGTGTCAAGG CAGTAGCAGC AGTTGCAGCT GATCAGCTTG
TGCTCCAGCT GGAAGGTGAC ACCGGCAATG GCGACGAGGT CTCCGAGGTG AGAATCGATG GAAATATACA GAGCTATAAA
TCTTCGAGTA CCTAGCTGAT TAGACAAGAA TTGATGAAGA AGCAATTAGT GGTAACTAAT CTTGATTGTT AATTTATTTC
TATCTTGTTC TTGGTCAGTT GATGGGAGCA GCTGAGGAGG AAGCAGCAGC ATGCGAGGAG GGGAAGAACA ACGACGAGTG
CGTGCAGAGG AGGCTGCTCA GCGACGCCCA CCTCGACTAC ATCTACACGC AGCACAAGAA CAAGCCTTGA TCGATCGATC
CATCCATCCA ACTACACGCT GAAATCCAAA GCTAATACAA GGAAGATCGA GATCGAGATA AATTAACCAA CTCTATATGC
ATATCTATCT ATCCATCTAC CTCTGCATGC TGTTTTCACT GCATCGATCG CTACTGTTCT GCAGTGCCAA TCACTGTCCG
TTTCTGTACA ATCTGTGATA CTACTAGCTA GTAGCAGTAC ATGGCATCGT TTTCCTTCAA GTGTTCGTTG GCTTTTACTT
AGTCCGGTGA GTGCTTGTGG GTTATTTCTG ACGAGGGAGT GTGATCAGTA CGCGTACTAA TGGTATTTTG GTTTGTCATG
GCATGATGAA ATTAAGCTGT GGTAGCAATA TAATGCATAT AT

Locus: Os11g0149400

Loading...

Locus: Os11g0149400

Loading...