Os11t0154500-01

Locus

Os11g0154500

Description

Blast disease-responsive transcription factor, Disease resistance

RAP-DB Gene Symbol Synonym(s)

NAC17, ONAC017, ONAC17, ONAC030, ONAC30, OsNAC111

RAP-DB Gene Name Synonym(s)

NAC DOMAIN-CONTAINING PROTEIN 17, NAC domain-containing protein 017, NAC domain-containing protein 17, NAC domain-containing protein 30

CGSNL Gene Symbol

NAC17

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 17

Oryzabase Gene Symbol Synonym(s)

ONAC017, ONAC17, ONAC030, ONAC30, OsNAC111

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 017, NAC domain-containing protein 17, NAC domain-containing protein 30

Transcript Evidence

AK106277

Protein Evidence

Q53QG7

Literature

PMID: 25014590

Note

Manual Curation

December 7, 2016

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain (IPR003441)

Full-length cDNA

002-100-H06 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0154500-01)

RiceXPro (AK106277)

Others

Oryzabase (11466)

KEGG (Os11t0154500-01)

Transcript

2329 bp

>Os11t0154500-01 Blast disease-responsive transcription factor, Disease resistance
AACCATGGATACAAGCTAGCTTTGCTTCTTCTTCTTCGTCTTCTTGTACCAAATCATTCA
AAGTTTTCTTTCTTCAAGCCTTCAATCTTCTATATATATCTCCCTCCATGATCAACCAGC
TATAGCTACCTCACTCCAACAATCGCCGACCACGATGGCCACCACGAGGAGCGGCGTCGG
CGGCGCCATCAGCGACCCATTTGCGACGCCGGGGTTCCGCTTCTACCCGACGGAGGAGGA
GCTTCTCGGCTTCTACCTCCGCCACCGCCTCGCCGGCACGAGGCCCGACGTCGAGCGCGT
CATCCCCGTCGTCGACGTCTACGGCTACCACCCGTCCCAGCTCGCCGCCCTGGCCGGGGA
GGCGAGCGCGCGCGACACGGAGCAGTGGTTCTTCTTCTGCCCGCGCGCCGAGCGGGAGCT
CCACGGCGGCCGGCCGGCGCGCACCACGCCGTCGGGGTACTGGAAGGCCACGGGATCCCC
GTCCTGCGTCATCTCCTCCGCCACAAACAGGGTCATCGGCGTCAAGCGCACCATGGTGTT
CTACCAGGGCCGCGCCCCCACCGGCACCAAGACCCGCTGGAAGATGAACGAGTACAAGGC
CGTCGCCGACGACGCCGACGCCGCCGCCGCCGCCATGCTCCACCCAATGGCGCCTCCCAG
GCTGAGGAACGAGCTGGGAGTGTGCCGGGTGTACATCAGCACGGGCACGCTGAGATCGTT
CGACCGCCGGCCGCTCGATAATCAAGCGGCGGCGCCCACCCAGCAACAGGTGATGCCATC
TTTGACGGCGGCGGCGGCGGTGAACACGAACCTCTGCGGCGGCGGCGGCGGCGTCGTGTT
CGCCGGTGCACAAGGAGACAGCTCCCGCGACTGCAGCTCGTCGTCGGGGTCGCGAGAACT
CGCCGGCGGCGCCGATGGGTCTGAAGACGACGCCATCGACTGGAACTCGCTCATCAGTAG
CGCCACTGCTGATGATCTCGGCTTCAACACCGTCGTTGGTTTTGATCCTAGCATCGTCGG
ATCATGGCCACAAGTCTAGTGCTTGATTACGCGTAATATAAAATTAATCGAGTTTAGTGA
TCAGTTAGTTTTTTGTTTTTTTGCAAGAAGTTCAAAAATTATTGCTGTGTGTTTTGCACT
GAGTAGCAAAGATGGGAGGATTAGAAGATGAATCGATTAGTTTGCAAATCAGGTGAATTA
ATTAGAGTAATTAACATCTGTAGTAATAGTAAGTAGAAAATCAAAATGAGAAGTTGTAGC
AGAAAGTATATACTACCACAAATCCGTTCTTAGTCCGACTCCGAATTAATCCCAGACGGA
AGATCGATCGAGACCGATTCGGAGATGGAGCCGATTTTGCTTGGAAATCAATGGAGAGGT
GAAATGGGATCGGATTCATGGGCGGCTACATAAGCAGGAGTCGAGAGGCCGCACCAGCTC
ATCATCATCATCATCATCATCTCATTCCCCGCGGTTCGATCCTCCTCGCGCTCTCGTCGT
CGTCGTCGTCATCTCCGGTTGATCGATCACTTCACTTCAAGTCGATGTCGGCCATGGCGG
CTCTCCCTGTGCTGCTCCCGACCCCGCCGAGGAGCAAGATGCTGCCGCTGCTCCCGACGC
CGTGCCTCGTCATCCTCCCCGCCAACTTCGCCACGTCGGTGGCCTCCAACGCGCCcaagc
ccggccgcgccgacgccgccgacaggtgggacacgcacaagaaacccaccagctcgtcgt
cgtcgtcaagctccagcaccgggagcgccagccgcgccgccgcctgcgagcgcaaagaac
ccggcagcccagcgtcgtcgtcgtcaagcAGCGGCGGGAAGCCCGGCCGAGCCGACTCCT
GCGAGCGCTGGGACACGAACAAGGCCAAGAACCAGATCATCAGCAGCGGCCGCCTCACGC
CGGCGTCGTCGTCGTCGACGAACGCGCGCTGGGACATGAACAAGGTCAAGAACACGGCGC
CGCCGTCGAACAGCAACAAGCGGCCGGTGAGCCGCGGGTCCGCCTCGGCCGAGCGCTGGG
ACATCAGCAAGAAGCATCGCTCGCAGGACGCCGCCGCCGCCGCTCTCGGCTCGGCGAGTG
ATCGGAAGTTGACGACGGTGGCAAAGCCGCAGCAGCCGCTGTTCTCTGGGCCGGCGTTCC
TGACCTCGCCGGAGCCAAGCATGCTTCCCATGCCCACCTTCTTGATGGCCCGATAGCTTC
TGCTTGTGCATTTCAACTTCAGATGAATCGGACTGTAGTTAGGATGGGATTTGATGAAGC
ATGTTATTCTTTGTGGGTCTGTTTGTGATCAATTGAATTGAATTGAACT

CDS

885 bp

>Os11t0154500-01 Blast disease-responsive transcription factor, Disease resistance
ATGGCCACCACGAGGAGCGGCGTCGGCGGCGCCATCAGCGACCCATTTGCGACGCCGGGG
TTCCGCTTCTACCCGACGGAGGAGGAGCTTCTCGGCTTCTACCTCCGCCACCGCCTCGCC
GGCACGAGGCCCGACGTCGAGCGCGTCATCCCCGTCGTCGACGTCTACGGCTACCACCCG
TCCCAGCTCGCCGCCCTGGCCGGGGAGGCGAGCGCGCGCGACACGGAGCAGTGGTTCTTC
TTCTGCCCGCGCGCCGAGCGGGAGCTCCACGGCGGCCGGCCGGCGCGCACCACGCCGTCG
GGGTACTGGAAGGCCACGGGATCCCCGTCCTGCGTCATCTCCTCCGCCACAAACAGGGTC
ATCGGCGTCAAGCGCACCATGGTGTTCTACCAGGGCCGCGCCCCCACCGGCACCAAGACC
CGCTGGAAGATGAACGAGTACAAGGCCGTCGCCGACGACGCCGACGCCGCCGCCGCCGCC
ATGCTCCACCCAATGGCGCCTCCCAGGCTGAGGAACGAGCTGGGAGTGTGCCGGGTGTAC
ATCAGCACGGGCACGCTGAGATCGTTCGACCGCCGGCCGCTCGATAATCAAGCGGCGGCG
CCCACCCAGCAACAGGTGATGCCATCTTTGACGGCGGCGGCGGCGGTGAACACGAACCTC
TGCGGCGGCGGCGGCGGCGTCGTGTTCGCCGGTGCACAAGGAGACAGCTCCCGCGACTGC
AGCTCGTCGTCGGGGTCGCGAGAACTCGCCGGCGGCGCCGATGGGTCTGAAGACGACGCC
ATCGACTGGAACTCGCTCATCAGTAGCGCCACTGCTGATGATCTCGGCTTCAACACCGTC
GTTGGTTTTGATCCTAGCATCGTCGGATCATGGCCACAAGTCTAG

Protein

295 aa

>Os11t0154500-01 Blast disease-responsive transcription factor, Disease resistance
MATTRSGVGGAISDPFATPGFRFYPTEEELLGFYLRHRLAGTRPDVERVIPVVDVYGYHP
SQLAALAGEASARDTEQWFFFCPRAERELHGGRPARTTPSGYWKATGSPSCVISSATNRV
IGVKRTMVFYQGRAPTGTKTRWKMNEYKAVADDADAAAAAMLHPMAPPRLRNELGVCRVY
ISTGTLRSFDRRPLDNQAAAPTQQQVMPSLTAAAAVNTNLCGGGGGVVFAGAQGDSSRDC
SSSSGSRELAGGADGSEDDAIDWNSLISSATADDLGFNTVVGFDPSIVGSWPQV*

5'UTR

chr11:2550551..2550704 (+ strand) : 154 bp

CDS

chr11:2550705..2551211 (+ strand) : 507 bp

chr11:2551296..2551673 (+ strand) : 378 bp

3'UTR

chr11:2551674..2552963 (+ strand) : 1290 bp

FASTA

>Os11t0154500-01 class=Sequence position=chr11:2550551..2552963 (+ strand)
AACCATGGAT ACAAGCTAGC TTTGCTTCTT CTTCTTCGTC TTCTTGTACC AAATCATTCA AAGTTTTCTT TCTTCAAGCC
TTCAATCTTC TATATATATC TCCCTCCATG ATCAACCAGC TATAGCTACC TCACTCCAAC AATCGCCGAC CACGATGGCC
ACCACGAGGA GCGGCGTCGG CGGCGCCATC AGCGACCCAT TTGCGACGCC GGGGTTCCGC TTCTACCCGA CGGAGGAGGA
GCTTCTCGGC TTCTACCTCC GCCACCGCCT CGCCGGCACG AGGCCCGACG TCGAGCGCGT CATCCCCGTC GTCGACGTCT
ACGGCTACCA CCCGTCCCAG CTCGCCGCCC TGGCCGGGGA GGCGAGCGCG CGCGACACGG AGCAGTGGTT CTTCTTCTGC
CCGCGCGCCG AGCGGGAGCT CCACGGCGGC CGGCCGGCGC GCACCACGCC GTCGGGGTAC TGGAAGGCCA CGGGATCCCC
GTCCTGCGTC ATCTCCTCCG CCACAAACAG GGTCATCGGC GTCAAGCGCA CCATGGTGTT CTACCAGGGC CGCGCCCCCA
CCGGCACCAA GACCCGCTGG AAGATGAACG AGTACAAGGC CGTCGCCGAC GACGCCGACG CCGCCGCCGC CGCCATGCTC
CACCCAATGG CGCCTCCCAG GGTACACACA TGAACTGATT AATGTATGAT GTGTTAATTA GTTAGTTAAT TATGTGCGTG
AAGTGTTTGA TGTTTGTTCG AGCAGCTGAG GAACGAGCTG GGAGTGTGCC GGGTGTACAT CAGCACGGGC ACGCTGAGAT
CGTTCGACCG CCGGCCGCTC GATAATCAAG CGGCGGCGCC CACCCAGCAA CAGGTGATGC CATCTTTGAC GGCGGCGGCG
GCGGTGAACA CGAACCTCTG CGGCGGCGGC GGCGGCGTCG TGTTCGCCGG TGCACAAGGA GACAGCTCCC GCGACTGCAG
CTCGTCGTCG GGGTCGCGAG AACTCGCCGG CGGCGCCGAT GGGTCTGAAG ACGACGCCAT CGACTGGAAC TCGCTCATCA
GTAGCGCCAC TGCTGATGAT CTCGGCTTCA ACACCGTCGT TGGTTTTGAT CCTAGCATCG TCGGATCATG GCCACAAGTC
TAGTGCTTGA TTACGCGTAA TATAAAATTA ATCGAGTTTA GTGATCAGTT AGTTTTTTGT TTTTTTGCAA GAAGTTCAAA
AATTATTGCT GTGTGTTTTG CACTGAGTAG CAAAGATGGG AGGATTAGAA GATGAATCGA TTAGTTTGCA AATCAGGTGA
ATTAATTAGA GTAATTAACA TCTGTAGTAA TAGTAAGTAG AAAATCAAAA TGAGAAGTTG TAGCAGAAAG TATATACTAC
CACAAATCCG TTCTTAGTCC GACTCCGAAT TAATCCCAGA CGGAAGATCG ATCGAGACCG ATTCGGAGAT GGAGCCGATT
TTGCTTGGAA ATCAATGGAG AGGTGAAATG GGATCGGATT CATGGGCGGC TACATAAGCA GGAGTCGAGA GGCCGCACCA
GCTCATCATC ATCATCATCA TCATCTCATT CCCCGCGGTT CGATCCTCCT CGCGCTCTCG TCGTCGTCGT CGTCATCTCC
GGTTGATCGA TCACTTCACT TCAAGTCGAT GTCGGCCATG GCGGCTCTCC CTGTGCTGCT CCCGACCCCG CCGAGGAGCA
AGATGCTGCC GCTGCTCCCG ACGCCGTGCC TCGTCATCCT CCCCGCCAAC TTCGCCACGT CGGTGGCCTC CAACGCGCCc
aagcccggcc gcgccgacgc cgccgacagg tgggacacgc acaagaaacc caccagctcg tcgtcgtcgt caagctccag
caccgggagc gccagccgcg ccgccgcctg cgagcgcaaa gaacccggca gcccagcgtc gtcgtcgtca agcAGCGGCG
GGAAGCCCGG CCGAGCCGAC TCCTGCGAGC GCTGGGACAC GAACAAGGCC AAGAACCAGA TCATCAGCAG CGGCCGCCTC
ACGCCGGCGT CGTCGTCGTC GACGAACGCG CGCTGGGACA TGAACAAGGT CAAGAACACG GCGCCGCCGT CGAACAGCAA
CAAGCGGCCG GTGAGCCGCG GGTCCGCCTC GGCCGAGCGC TGGGACATCA GCAAGAAGCA TCGCTCGCAG GACGCCGCCG
CCGCCGCTCT CGGCTCGGCG AGTGATCGGA AGTTGACGAC GGTGGCAAAG CCGCAGCAGC CGCTGTTCTC TGGGCCGGCG
TTCCTGACCT CGCCGGAGCC AAGCATGCTT CCCATGCCCA CCTTCTTGAT GGCCCGATAG CTTCTGCTTG TGCATTTCAA
CTTCAGATGA ATCGGACTGT AGTTAGGATG GGATTTGATG AAGCATGTTA TTCTTTGTGG GTCTGTTTGT GATCAATTGA
ATTGAATTGA ACT

Locus: Os11g0154500

Loading...

Locus: Os11g0154500

Loading...