Os11t0154500-02

Locus

Os11g0154500

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC17

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 17

Oryzabase Gene Symbol Synonym(s)

ONAC017, ONAC17, ONAC030, ONAC30, OsNAC111

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 017, NAC domain-containing protein 17, NAC domain-containing protein 30

Transcript Evidence

AK109939 (DDBJ, Best hit)

Protein Evidence

Q9SXQ0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

002-154-A12 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0154500-02)

RiceXPro (AK109939)

Others

Oryzabase (11466)

KEGG (Os11t0154500-02)

Transcript

1172 bp

>Os11t0154500-02 No apical meristem (NAM) protein domain containing protein.
AGCTACCTCACTCCAACAATCGCCGACCACGATGGCCACCACGAGGAGCGGCGTCGGCGG
CGCCATCAGCGACCCATTTGCGACGCCGGGGTTCCGCTTCTACCCGACGGAGGAGGAGCT
TCTCGGCTTCTACCTCCGCCACCGCCTCGCCGGCACGAGGCCCGACGTCGAGCGCGTCAT
CCCCGTCGTCGACGTCTACGGCTACCACCCGTCCCAGCTCGCCGCCCTGGCCGGGGAGGC
GAGCGCGCGCGACACGGAGCAGTGGTTCTTCTTCTGCCCGCGCGCCGAGCGGGAGCTCCA
CGGCGGCCGGCCGGCGCGCACCACGCCGTCGGGGTACTGGAAGGCCACGGGATCCCCGTC
CTGCGTCATCTCCTCCGCCACAAACAGGGTCATCGGCGTCAAGCGCACCATGGTGTTCTA
CCAGGGCCGCGCCCCCACCGGCACCAAGACCCGCTGGAAGATGAACGAGTACAAGGCCGT
CGCCGACGACGCCGACGCCGCCGCCGCCGCCATGCTCCACCCAATGGCGCCTCCCAGGCT
GAGGAACGAGCTGGGAGTGTGCCGGGTGTACATCAGCACGGGCACGCTGAGATCGTTCGA
CCGCCGGCCGCTCGATAATCAAGCGGCGGCGCCCACCCAGCAACAGGTGATGCCATCTTT
GACGGCGGCGGCGGCGGTGAACACGAACCTCTGCGGCGGCGGCGGCGGCGTCGTGTTCGC
CGGTGCACAAGGAGACAGCTCCCGCGACTGCAGCTCGTCGTCGGGGTCGCGAGAACTCGC
CGGCGGCGCCGATGGGTCTGAAGACGACGCCATCGACTGGAACTCGCTCATCAGTAGCGC
CACTGCTGATGATCTCGGCTTCAACACCGTCGTTGGTTTTGATCCTAGCATCGTCGGATC
ATGGCCACAAGTCTAGTGCTTGATTACGCGTAATATAAAATTAATCGAGTTTAGTGATCA
GTTAGTTTTTTGTTTTTTTGCAAGAAGTTCAAAAATTATTGCTGTGTGTTTTGCACTGAG
TAGCAAAGATGGGAGGATTAGAAGATGAATCGATTAGTTTGCAAATCAGGTGAATTAATT
AGAGTAATTAACATCTGTAGTAATAGTAAGTAGAAAATCAAAATGAGAAGTTGTAGCAGA
AAGTATATACTACCACAAATCCGTTCTTAGTC

CDS

885 bp

>Os11t0154500-02 No apical meristem (NAM) protein domain containing protein.
ATGGCCACCACGAGGAGCGGCGTCGGCGGCGCCATCAGCGACCCATTTGCGACGCCGGGG
TTCCGCTTCTACCCGACGGAGGAGGAGCTTCTCGGCTTCTACCTCCGCCACCGCCTCGCC
GGCACGAGGCCCGACGTCGAGCGCGTCATCCCCGTCGTCGACGTCTACGGCTACCACCCG
TCCCAGCTCGCCGCCCTGGCCGGGGAGGCGAGCGCGCGCGACACGGAGCAGTGGTTCTTC
TTCTGCCCGCGCGCCGAGCGGGAGCTCCACGGCGGCCGGCCGGCGCGCACCACGCCGTCG
GGGTACTGGAAGGCCACGGGATCCCCGTCCTGCGTCATCTCCTCCGCCACAAACAGGGTC
ATCGGCGTCAAGCGCACCATGGTGTTCTACCAGGGCCGCGCCCCCACCGGCACCAAGACC
CGCTGGAAGATGAACGAGTACAAGGCCGTCGCCGACGACGCCGACGCCGCCGCCGCCGCC
ATGCTCCACCCAATGGCGCCTCCCAGGCTGAGGAACGAGCTGGGAGTGTGCCGGGTGTAC
ATCAGCACGGGCACGCTGAGATCGTTCGACCGCCGGCCGCTCGATAATCAAGCGGCGGCG
CCCACCCAGCAACAGGTGATGCCATCTTTGACGGCGGCGGCGGCGGTGAACACGAACCTC
TGCGGCGGCGGCGGCGGCGTCGTGTTCGCCGGTGCACAAGGAGACAGCTCCCGCGACTGC
AGCTCGTCGTCGGGGTCGCGAGAACTCGCCGGCGGCGCCGATGGGTCTGAAGACGACGCC
ATCGACTGGAACTCGCTCATCAGTAGCGCCACTGCTGATGATCTCGGCTTCAACACCGTC
GTTGGTTTTGATCCTAGCATCGTCGGATCATGGCCACAAGTCTAG

Protein

295 aa

>Os11t0154500-02 No apical meristem (NAM) protein domain containing protein.
MATTRSGVGGAISDPFATPGFRFYPTEEELLGFYLRHRLAGTRPDVERVIPVVDVYGYHP
SQLAALAGEASARDTEQWFFFCPRAERELHGGRPARTTPSGYWKATGSPSCVISSATNRV
IGVKRTMVFYQGRAPTGTKTRWKMNEYKAVADDADAAAAAMLHPMAPPRLRNELGVCRVY
ISTGTLRSFDRRPLDNQAAAPTQQQVMPSLTAAAAVNTNLCGGGGGVVFAGAQGDSSRDC
SSSSGSRELAGGADGSEDDAIDWNSLISSATADDLGFNTVVGFDPSIVGSWPQV*

5'UTR

chr11:2550674..2550704 (+ strand) : 31 bp

CDS

chr11:2550705..2551211 (+ strand) : 507 bp

chr11:2551296..2551673 (+ strand) : 378 bp

3'UTR

chr11:2551674..2551929 (+ strand) : 256 bp

FASTA

>Os11t0154500-02 class=Sequence position=chr11:2550674..2551929 (+ strand)
AGCTACCTCA CTCCAACAAT CGCCGACCAC GATGGCCACC ACGAGGAGCG GCGTCGGCGG CGCCATCAGC GACCCATTTG
CGACGCCGGG GTTCCGCTTC TACCCGACGG AGGAGGAGCT TCTCGGCTTC TACCTCCGCC ACCGCCTCGC CGGCACGAGG
CCCGACGTCG AGCGCGTCAT CCCCGTCGTC GACGTCTACG GCTACCACCC GTCCCAGCTC GCCGCCCTGG CCGGGGAGGC
GAGCGCGCGC GACACGGAGC AGTGGTTCTT CTTCTGCCCG CGCGCCGAGC GGGAGCTCCA CGGCGGCCGG CCGGCGCGCA
CCACGCCGTC GGGGTACTGG AAGGCCACGG GATCCCCGTC CTGCGTCATC TCCTCCGCCA CAAACAGGGT CATCGGCGTC
AAGCGCACCA TGGTGTTCTA CCAGGGCCGC GCCCCCACCG GCACCAAGAC CCGCTGGAAG ATGAACGAGT ACAAGGCCGT
CGCCGACGAC GCCGACGCCG CCGCCGCCGC CATGCTCCAC CCAATGGCGC CTCCCAGGGT ACACACATGA ACTGATTAAT
GTATGATGTG TTAATTAGTT AGTTAATTAT GTGCGTGAAG TGTTTGATGT TTGTTCGAGC AGCTGAGGAA CGAGCTGGGA
GTGTGCCGGG TGTACATCAG CACGGGCACG CTGAGATCGT TCGACCGCCG GCCGCTCGAT AATCAAGCGG CGGCGCCCAC
CCAGCAACAG GTGATGCCAT CTTTGACGGC GGCGGCGGCG GTGAACACGA ACCTCTGCGG CGGCGGCGGC GGCGTCGTGT
TCGCCGGTGC ACAAGGAGAC AGCTCCCGCG ACTGCAGCTC GTCGTCGGGG TCGCGAGAAC TCGCCGGCGG CGCCGATGGG
TCTGAAGACG ACGCCATCGA CTGGAACTCG CTCATCAGTA GCGCCACTGC TGATGATCTC GGCTTCAACA CCGTCGTTGG
TTTTGATCCT AGCATCGTCG GATCATGGCC ACAAGTCTAG TGCTTGATTA CGCGTAATAT AAAATTAATC GAGTTTAGTG
ATCAGTTAGT TTTTTGTTTT TTTGCAAGAA GTTCAAAAAT TATTGCTGTG TGTTTTGCAC TGAGTAGCAA AGATGGGAGG
ATTAGAAGAT GAATCGATTA GTTTGCAAAT CAGGTGAATT AATTAGAGTA ATTAACATCT GTAGTAATAG TAAGTAGAAA
ATCAAAATGA GAAGTTGTAG CAGAAAGTAT ATACTACCAC AAATCCGTTC TTAGTC

Locus: Os11g0154500

Loading...

Locus: Os11g0154500

Loading...