Os11t0170300-01

Locus

Os11g0170300

Description

Similar to CBS domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCBSCBSPB2

Oryzabase Gene Name Synonym(s)

cystathionine b-synthase domain containing protein OsCBSCBSPB2, CBS domain containing protein OsCBSCBSPB2

Transcript Evidence

AK240940 (DDBJ, Best hit)

Protein Evidence

NP_001148069.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Phox/Bem1p (IPR000270)

Cystathionine beta-synthase, core (IPR000644)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

J065042D15 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0170300-01)

Others

Oryzabase (10352)

KEGG (Os11t0170300-01)

Transcript

2288 bp

>Os11t0170300-01 Similar to CBS domain containing protein.
GTGGCGTGTGGGAGCCCAGTCGAACCGGCCACCTCTCCCCCCCTCCAATTTTTCCGGCGG
CCGCCACCGCCGCCGACGATCCCTCTCTCCGCCCACTGCCAACTACATCGCTGATTCCGG
AGCAGCGGAGGCGGCGGCGGACGAAGCCATGAGTGCCGCCGGCGTGGCGCTGAACCGCCG
CACCCGCAGCCGCCCGCCGTCGGTGGCCTCCTCCCAGAAGTCCGATGATCCCGCCGCCGC
GGTCGCCGCTATCTCCACCGCCGAAGCCACGCCCTCCCCCAGCCACGCCGCAGGGGAGAG
GACGGTGAAGAAGCTGCGGCTGACGAAGGCGGTGACGATCCCGGAGGGGACGACGGTGGC
GGAGGCTTGCCAGCGGATGGCGGCGAGGAGGGTGGACGCCGTGCTGCTCACGGACGCCAA
CGGATTACTCTCCGGCATCGTCACCGATAAAGACATAGCTAAAAGGGTGATTGCAGAGGG
GTTGCGGGTTGAGCAAACAATCACCTCCAAGATCATGACACGAACTCCTGTTTATGTCAT
GTCTGACACACTTGCTATTGAAGCACTGCAGAAAATGGTCCAAGGAAAATTTAGGCACCT
CCCAGTGGTGGAAAATGGTGAGGTTATTGCCATGCTAGACATTGCAAAATGCCTCTATGA
TGCAATATCAAGACTGGAAAAGGCAGCAGAACAGGGAAGTGCATTAGCAGCTGCTGTAGA
AGGGGTTGAGCGTCAAGTGGGAGACAACTTGCCAGATCATTCCAGTGTAATAGAAACTCT
AAGAGAAAGGATGCTTAAACCTTCATTGTCAACCATTATCTCGGAGAACACAAAAGTAGC
AATTGTTTCACCATGGGATCCTGTTTGTGTAGCAGCACGAAAAATGCATGAATTACGGGT
TAACTCAGTGGTTATCACTGCAGGAAATTCATTGCAAGGGATTTTTACCTCAAAGGATGT
GCTTATGCGCGTTGTGACACAAAATCTCTCTCCTGAGTTAACTCATGTAGAAAAGGTAAT
GACTGCACACCCTGAATGTGCTACATTAGACACATCAATTCTCGATGCTCTGCATATTAT
GCGCGATGGCAAATTCTTGCATATTCCTGTTGTTGATGGAGAAGGGAGAGTTGTTGCTTG
CTTGGATGTTCTGCAGATTACCCATGCAGCCATTTCAATGGTTGAAGGAGGTCCTGAGAC
CACGAATGGTGTGGCAAACACAATAATGCAAAAGTTTTGGGACTCAGCTCTTGCTTTGGA
GCCCCCAGATGAGGAATTTGATAGTCGCAGTGAAATATCTTTGCTCATGCCATCAGAGGC
TGGAGATGGCAGGAGTAGCATTAATCCTCCTGTTGTTGGCAATTCATTTGTCTTTAAGAT
TGAGGACCAGAAGGGACGTATGCATAGATTTGCATGTGGTTCAGAGAGTTTACATGAGCT
GGTGTCTTCTGTGGTGCAAAGATTAGGCATTGATGGCGAAAAGGGCACAGTTCAACTTTT
GTATGATGATGATGAAGGTGATAGGGTGTTGCTCACTACGGATACTGATCTTACCGGGGC
TGTGCTCCATGCTAAATCTTCTGGATTGAAGTCATTGAGGTTGTACACTGATGAGTCAAA
TTCCAGTTCTGAGGTGACAAAACACAGTTCTGAAGTAACAAAGCACGCTTCTGAAGTGAC
AAAGCACACTTCTGAAGTGACAAAGCAACCTCCAGAGTTGACATCTTCACACACAAGTCA
GTTGACCCCTGCTCATTATGGCCTGATGGCAGGTGCAGTTGTTCTAACAGGGGTTGTGGT
GATGATTTACTTGAGACGCTCTAAAGTGTGATTGTCTGAGATAAATTTTCCACACATGGC
TCTAATTTAAAATATAAACAGCACGATTGAACTTCTTAGCTTATCAACAGATTAAGAGTG
AAGAGACAGATGGACATCGACGATAAAGTACGGCGTACATGGAGTCAAGGACCTAAAAGC
AATCAACTGACAGTCTCAGGTTTTCTCAGGAACTGAGGAACTGGGCTGGAAGTGGAACTA
ACAAAATATGGTATTGCTCCATTTTTGTTTTTGCATGCAGATTTTTCACAGATGTAGTGA
AATGCATGTTATGCATAATTGCTATATGAAATTATGAATTACTGGTCACCACGAATCTAG
TGGATTCTTCCCTGACAGAACCCAAGAAGGCAAGAAATGATATGAAGAATACAACAATGT
ATGATCATTCTTTACTAATGTGAGAAAGAATTAATATATGCAGTATAATCATTCTTTATT
AATGTGAG

CDS

1683 bp

>Os11t0170300-01 Similar to CBS domain containing protein.
ATGAGTGCCGCCGGCGTGGCGCTGAACCGCCGCACCCGCAGCCGCCCGCCGTCGGTGGCC
TCCTCCCAGAAGTCCGATGATCCCGCCGCCGCGGTCGCCGCTATCTCCACCGCCGAAGCC
ACGCCCTCCCCCAGCCACGCCGCAGGGGAGAGGACGGTGAAGAAGCTGCGGCTGACGAAG
GCGGTGACGATCCCGGAGGGGACGACGGTGGCGGAGGCTTGCCAGCGGATGGCGGCGAGG
AGGGTGGACGCCGTGCTGCTCACGGACGCCAACGGATTACTCTCCGGCATCGTCACCGAT
AAAGACATAGCTAAAAGGGTGATTGCAGAGGGGTTGCGGGTTGAGCAAACAATCACCTCC
AAGATCATGACACGAACTCCTGTTTATGTCATGTCTGACACACTTGCTATTGAAGCACTG
CAGAAAATGGTCCAAGGAAAATTTAGGCACCTCCCAGTGGTGGAAAATGGTGAGGTTATT
GCCATGCTAGACATTGCAAAATGCCTCTATGATGCAATATCAAGACTGGAAAAGGCAGCA
GAACAGGGAAGTGCATTAGCAGCTGCTGTAGAAGGGGTTGAGCGTCAAGTGGGAGACAAC
TTGCCAGATCATTCCAGTGTAATAGAAACTCTAAGAGAAAGGATGCTTAAACCTTCATTG
TCAACCATTATCTCGGAGAACACAAAAGTAGCAATTGTTTCACCATGGGATCCTGTTTGT
GTAGCAGCACGAAAAATGCATGAATTACGGGTTAACTCAGTGGTTATCACTGCAGGAAAT
TCATTGCAAGGGATTTTTACCTCAAAGGATGTGCTTATGCGCGTTGTGACACAAAATCTC
TCTCCTGAGTTAACTCATGTAGAAAAGGTAATGACTGCACACCCTGAATGTGCTACATTA
GACACATCAATTCTCGATGCTCTGCATATTATGCGCGATGGCAAATTCTTGCATATTCCT
GTTGTTGATGGAGAAGGGAGAGTTGTTGCTTGCTTGGATGTTCTGCAGATTACCCATGCA
GCCATTTCAATGGTTGAAGGAGGTCCTGAGACCACGAATGGTGTGGCAAACACAATAATG
CAAAAGTTTTGGGACTCAGCTCTTGCTTTGGAGCCCCCAGATGAGGAATTTGATAGTCGC
AGTGAAATATCTTTGCTCATGCCATCAGAGGCTGGAGATGGCAGGAGTAGCATTAATCCT
CCTGTTGTTGGCAATTCATTTGTCTTTAAGATTGAGGACCAGAAGGGACGTATGCATAGA
TTTGCATGTGGTTCAGAGAGTTTACATGAGCTGGTGTCTTCTGTGGTGCAAAGATTAGGC
ATTGATGGCGAAAAGGGCACAGTTCAACTTTTGTATGATGATGATGAAGGTGATAGGGTG
TTGCTCACTACGGATACTGATCTTACCGGGGCTGTGCTCCATGCTAAATCTTCTGGATTG
AAGTCATTGAGGTTGTACACTGATGAGTCAAATTCCAGTTCTGAGGTGACAAAACACAGT
TCTGAAGTAACAAAGCACGCTTCTGAAGTGACAAAGCACACTTCTGAAGTGACAAAGCAA
CCTCCAGAGTTGACATCTTCACACACAAGTCAGTTGACCCCTGCTCATTATGGCCTGATG
GCAGGTGCAGTTGTTCTAACAGGGGTTGTGGTGATGATTTACTTGAGACGCTCTAAAGTG
TGA

Protein

561 aa

>Os11t0170300-01 Similar to CBS domain containing protein.
MSAAGVALNRRTRSRPPSVASSQKSDDPAAAVAAISTAEATPSPSHAAGERTVKKLRLTK
AVTIPEGTTVAEACQRMAARRVDAVLLTDANGLLSGIVTDKDIAKRVIAEGLRVEQTITS
KIMTRTPVYVMSDTLAIEALQKMVQGKFRHLPVVENGEVIAMLDIAKCLYDAISRLEKAA
EQGSALAAAVEGVERQVGDNLPDHSSVIETLRERMLKPSLSTIISENTKVAIVSPWDPVC
VAARKMHELRVNSVVITAGNSLQGIFTSKDVLMRVVTQNLSPELTHVEKVMTAHPECATL
DTSILDALHIMRDGKFLHIPVVDGEGRVVACLDVLQITHAAISMVEGGPETTNGVANTIM
QKFWDSALALEPPDEEFDSRSEISLLMPSEAGDGRSSINPPVVGNSFVFKIEDQKGRMHR
FACGSESLHELVSSVVQRLGIDGEKGTVQLLYDDDEGDRVLLTTDTDLTGAVLHAKSSGL
KSLRLYTDESNSSSEVTKHSSEVTKHASEVTKHTSEVTKQPPELTSSHTSQLTPAHYGLM
AGAVVLTGVVVMIYLRRSKV*

5'UTR

chr11:3423863..3424010 (- strand) : 148 bp

CDS

chr11:3423720..3423862 (- strand) : 143 bp

chr11:3423475..3423634 (- strand) : 160 bp

chr11:3422736..3422868 (- strand) : 133 bp

chr11:3421790..3421960 (- strand) : 171 bp

chr11:3421412..3421490 (- strand) : 79 bp

chr11:3421068..3421181 (- strand) : 114 bp

chr11:3420901..3420967 (- strand) : 67 bp

chr11:3420695..3420800 (- strand) : 106 bp

chr11:3420545..3420603 (- strand) : 59 bp

chr11:3420348..3420457 (- strand) : 110 bp

chr11:3420141..3420268 (- strand) : 128 bp

chr11:3419978..3420060 (- strand) : 83 bp

chr11:3419448..3419537 (- strand) : 90 bp

chr11:3419093..3419332 (- strand) : 240 bp

3'UTR

chr11:3418636..3419092 (- strand) : 457 bp

FASTA

>Os11t0170300-01 class=Sequence position=chr11:3418636..3424010 (- strand)
GTGGCGTGTG GGAGCCCAGT CGAACCGGCC ACCTCTCCCC CCCTCCAATT TTTCCGGCGG CCGCCACCGC CGCCGACGAT
CCCTCTCTCC GCCCACTGCC AACTACATCG CTGATTCCGG AGCAGCGGAG GCGGCGGCGG ACGAAGCCAT GAGTGCCGCC
GGCGTGGCGC TGAACCGCCG CACCCGCAGC CGCCCGCCGT CGGTGGCCTC CTCCCAGAAG TCCGATGATC CCGCCGCCGC
GGTCGCCGCT ATCTCCACCG CCGAAGCCAC GCCCTCCCCC AGCCACGCCG CGTACCAAGA TTGCCTCTCT CTCTCTCTCT
CCTCGCCGCC TTTGATCCTT ACAGAGATTG GATTTTTTTT TCTTCTTTTT CTTCAGAGGG GAGAGGACGG TGAAGAAGCT
GCGGCTGACG AAGGCGGTGA CGATCCCGGA GGGGACGACG GTGGCGGAGG CTTGCCAGCG GATGGCGGCG AGGAGGGTGG
ACGCCGTGCT GCTCACGGAC GCCAACGGAT TACTCTCCGG CATCGTCACC GATAAAGTAA TTTTCCTCTT CTTATTTTAT
TTTTCAAATC AATCTGTGAT GTGTTTTCTA AGCTGGAGGT GGTTGCGATT GGCTAATAAG TGGGTTTTGG TATAATTGTA
CTCTACGAAA CTCCATATAG AGTTTTGCTT GTGTCTACAT CAAGTGCCTA GATTTCTTAA AGATGGACGC TTTATGTTAT
TGCAACTTTT TCTTAGGACT GCACAACTCC TCTTTGCCAC ATCTGACTTG TTCAATAATG AATCGTTGAG AGTTTAAATA
CTTTGACTAA TGCTCCATGA ATCAATTGTT ATTTATGTAT TTTGCTTCTT ATGTATTCGA CTGCGGCCCA ACCATGTTGT
GTTTTCTTTT TTTCTTTTTT CTTTGCGGGT GCCTATGTTA TGTGTTCGAC TGTAAGTTTG TACAAATCAC AGCAATGATT
TAATACTATA AGTACATGCC AAAGTATCTT ATGCTTATGG TACTTAAAGC TTAAAGTAGA TGCTTTATCT TTTCGCCCTT
ATTTGCATAA TTGGGATATA GGACATGGCT GGTACTTCTA GCTTAAAGGA GATAAGGAGA TTCTTTATCG TTTCGTTTCT
TATTTGCTTA ATTTGGATAC AGGACATAGC TAAAAGGGTG ATTGCAGAGG GGTTGCGGGT TGAGCAAACA ATCACCTCCA
AGATCATGAC ACGAACTCCT GTTTATGTCA TGTCTGACAC ACTTGCTATT GAAGCACTGC AGAAAATGGT CCAAGGTATC
TTGTAATCTT AAAGCATAGA CCCAGTGATC TGCCTGTTTG GTTCAGATAC TTCGGACTTG GGTCAATTGA ACTCACTTCC
TTTAACTCCT ACAAGCTGCT GTGGAGTATA TTTCATATGC ATTAGTTATC TTTGTTGTAG CTACTTATTG TGAGAATGTT
TTGGATAATA ATGTTGTGAT CAGTAAATCC TTGTTGACAA TGTTGGACTA GCCATATTGT TTAAAATTAT CACTATTTTT
GTATTTCTGA GAAGCTTCAA TCAGCATTCT CTTTCCCTGT TTACAGTATA ATCTCTTTGA AAATCTATTC GGTCAAGACT
ATTAAACTAT TTGAGTACTT CCATTTTTTT TTCTCTTTTC TTGCAGTCTT TTATGCATTC ATCAGTTTGT CTTTTCAAGT
TTGTTGCATT TCCTTTTAGC AATAATCTAA ATTAATTTCA GAGGAACTTT CTAATTTCTA GACATTCTTC CAGTATTGAG
AGTCTCATTG GCTAAATTTA ATTTACTATA GGACAACTGC ATATCTTTAA CCTCTGAACA TCAGCATTCT ACAATCCCAA
TGACCTGTAT GCATATTAAG AAAGCATTAT TCACTTGTTA ATAAAGCAGT AACAGCTATG CTATGAAATC AATGGTCATT
GTTAGAAAGT TTGTTTCTTA TTTTAATAAC ATGGGCTCAT CATTCCAATT GTTTTATATA CTGTCTCTCC GTATTCCAAG
TATGTTCATT TTCCTCTCCT TAGAGCTAAT ATGAAACACT CACGTTTTAG GAAAATTTAG GCACCTCCCA GTGGTGGAAA
ATGGTGAGGT TATTGCCATG CTAGACATTG CAAAATGCCT CTATGATGCA ATATCAAGAC TGGAAAAGGC AGCAGAACAG
GGAAGTGCAT TAGCAGCTGC TGTAGAAGGG GTTGAGCGTC AAGTGGGAGA CAACTTGCCA GGTTTTCTGT TGCATATTGT
GCTGACTAGT TATTTTCCTT TGTTTCACTC TAAATGTTCA TTGCTACACA AGAACAGAAA ATGTATACTG CAGTCAGTAG
CCATGTGAAC TAGGTTATGA GCAATTTGTA ATACCCAGTT TATCCCAAAG AATAATGAGA TGATTCTCAG GATTGGAACT
ATGTTTGATG TTTGATGCTT TACTGTATAC ATTTGTACAT TATTTTCTAA ATAGATTTCA CTTAACCACT GTTTTCTGGT
CTTGTTTAGC TGACCAAATT ACTGTGTTTA CCATTTGCAG ATCATTCCAG TGTAATAGAA ACTCTAAGAG AAAGGATGCT
TAAACCTTCA TTGTCAACCA TTATCTCGGA GAACACAAAG TACATGAAAT TTTTATTAGT ATTCCATTTT TGGGATAAAT
CCACACCATG CCACTGAGTT TTATTCATAT CCATAGTAGA CCACTCACTG TGAGGATGAC ATGTGGCCAT GTGGGCAGTG
AGACATCAGT AGTATATTGT AGACACTGAA TGAAACTTGG TGGTATAAAA TGGATCATCC AACATAATGT GGTTTGAATC
ATGGGAGTTA CCTCTTTTTT AACTTGCAGA GTAGCAATTG TTTCACCATG GGATCCTGTT TGTGTAGCAG CACGAAAAAT
GCATGAATTA CGGGTTAACT CAGTGGTTAT CACTGCAGGA AATTCATTGC AAGGGATTTT TACGTAAGCA TTTCAATACT
TTTATGGAAT AATTCTTTAT TCTAGAGTTT ATATTATTTT ATATTTCTTA AGGCACTAAT GGCTATGTCA TTGTGAAATT
CAGCTCAAAG GATGTGCTTA TGCGCGTTGT GACACAAAAT CTCTCTCCTG AGTTAACTCA TGTAGAAAAG GTTGTTTCTC
CAGATTGAAT ATTATTTTAA ATGATTTAAA CTACCGATGG GTTATACAAT TCATTCTAGA CTAACAGCAT TACTCACTGT
TTTGCTCAAG GTAATGACTG CACACCCTGA ATGTGCTACA TTAGACACAT CAATTCTCGA TGCTCTGCAT ATTATGCGCG
ATGGCAAATT CTTGCATATT CCTGTTGTTG ATGGAGGTAA CACTTGACTC TTCTTCAGCC TAAGGTTTCT CTTTATGGTA
CTAGTATTTT ATATCTGACT GAACTTTTTA ATTTTAAAAA TGAACAGAAG GGAGAGTTGT TGCTTGCTTG GATGTTCTGC
AGATTACCCA TGCAGCCATT TCAATGGTCT CTCTGCACAT GCGTATTTTT TCGCTTCTCA TTCCTTGCTT TTTCCTTATG
GTTTCCGTTC ATCTAACATC ATTCTGTGTG AAGGTTGAAG GAGGTCCTGA GACCACGAAT GGTGTGGCAA ACACAATAAT
GCAAAAGTTT TGGGACTCAG CTCTTGCTTT GGAGCCCCCA GATGAGGAAT TTGATAGTCG CAGGTTAATT AACGCTTCCT
TTTTTGTCCT TTGTCCTCTT TTTCAAATTT GCAATTCTTA CCTGCATTTT TGCATTGTTC AGTGAAATAT CTTTGCTCAT
GCCATCAGAG GCTGGAGATG GCAGGAGTAG CATTAATCCT CCTGTTGTTG GCAATTCATT TGTCTTTAAG ATTGAGGACC
AGAAGGGACG TATGCATAGA TTTGCATGTG GTAGGTGTTA CAAGTTGGTT GAATGTTAAA CTATGGTTGT ACTGCTCTAA
CTAACAGTTT GGTTTGTTCC GTCTCTGCAG GTTCAGAGAG TTTACATGAG CTGGTGTCTT CTGTGGTGCA AAGATTAGGC
ATTGATGGCG AAAAGGGCAC AGTTCAACTT TTGGTAATTT GTTGTCCCTT ATTTTATGTA TTTCGTTAGT GTTTGGAAGC
AAAAAAAAAA AAAAAGGTTG TCAGTCTGAT CATCGTTCAA GAAGTTCTGT TGTTTTATAT GGAATGCTAA CTGATGTAAG
AAAGTACTTA ACCACCATCC ACTTCAAGAA TAAGAATTTA TCTTTATCTT ATGTCACCCC ATATCTGTAT CTCAGTATCC
TGATTTTCTT ATAGACATTA TATTGAACCA TAGAGACTAT ATATAGTGTT GCCTGTATTA TAGAAATTTA TAAGTTGACT
GGCATAAAAC GGTCTTATTT TGAGTAGCGC TGGTAACTAA TTATCCCATG AAATTGTGAA TGCACCCTTA ACTGTTACAA
GCACTTCACT TACAGCTCAA TTATCACACC TCAGCCACAA TTACAAGCTA AATTTTGATA ATGTTCCGTA CAGTATGATG
ATGATGAAGG TGATAGGGTG TTGCTCACTA CGGATACTGA TCTTACCGGG GCTGTGCTCC ATGCTAAATC TTCTGGATTG
AAGGTTTGTC TTTTCTGTAA TCCTCAAATA GATTGGTCCC TCTGTTTTCA CATTGCGTTC TTTTTTTGTT CATTGGATTA
TGACTATTGC TTCACCGGAG TGAAATTTTC AATTTCAGTC ATTGAGGTTG TACACTGATG AGTCAAATTC CAGTTCTGAG
GTGACAAAAC ACAGTTCTGA AGTAACAAAG CACGCTTCTG AAGTGACAAA GCACACTTCT GAAGTGACAA AGCAACCTCC
AGAGTTGACA TCTTCACACA CAAGTCAGTT GACCCCTGCT CATTATGGCC TGATGGCAGG TGCAGTTGTT CTAACAGGGG
TTGTGGTGAT GATTTACTTG AGACGCTCTA AAGTGTGATT GTCTGAGATA AATTTTCCAC ACATGGCTCT AATTTAAAAT
ATAAACAGCA CGATTGAACT TCTTAGCTTA TCAACAGATT AAGAGTGAAG AGACAGATGG ACATCGACGA TAAAGTACGG
CGTACATGGA GTCAAGGACC TAAAAGCAAT CAACTGACAG TCTCAGGTTT TCTCAGGAAC TGAGGAACTG GGCTGGAAGT
GGAACTAACA AAATATGGTA TTGCTCCATT TTTGTTTTTG CATGCAGATT TTTCACAGAT GTAGTGAAAT GCATGTTATG
CATAATTGCT ATATGAAATT ATGAATTACT GGTCACCACG AATCTAGTGG ATTCTTCCCT GACAGAACCC AAGAAGGCAA
GAAATGATAT GAAGAATACA ACAATGTATG ATCATTCTTT ACTAATGTGA GAAAGAATTA ATATATGCAG TATAATCATT
CTTTATTAAT GTGAG

Locus: Os11g0170300

Loading...

Locus: Os11g0170300

Loading...