Os11t0171500-01

Locus

Os11g0171500

Description

Calcium-dependent protein kinase

RAP-DB Gene Symbol Synonym(s)

CDPK24, OsCDPK14, OsCPK24

RAP-DB Gene Name Synonym(s)

CALCIUM-DEPENDENT PROTEIN KINASE 24, calcium-dependent protein kinase 14

CGSNL Gene Symbol

CDPK24

CGSNL Gene Name

CALCIUM-DEPENDENT PROTEIN KINASE 24

Oryzabase Gene Symbol Synonym(s)

OsCDPK24, OsCPK24, OsCDPK14

Oryzabase Gene Name Synonym(s)

calcium-dependent protein kinase, calcium-dependent protein kinase 14

Transcript Evidence

AK102308

Protein Evidence

Q53P85

Literature

PMID: 27627618

PMID: 16255173

PMID: 15695435

Note

Manual Curation

April 28, 2017

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

EF-hand domain pair (IPR011992)

EF-hand domain (IPR002048)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

EF-Hand 1, calcium-binding site (IPR018247)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Full-length cDNA

J033090B04 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0171500-01)

RiceXPro (AK102308)

Others

Oryzabase (8075)

KEGG (Os11t0171500-01 (EC:2.7.11.1))

Transcript

2523 bp

>Os11t0171500-01 Calcium-dependent protein kinase
ATAGATACGACCTGGCTGCCCTCACAAAAATACTTCACCAAACCACCCTCCTCCTCCTCC
CCCTTTACCATTTCCAAGTTCCAACCCCCAAAAAAAATCCAACCAAAAAGCGGAGATTTT
CCAACTCTTATCATCTCCTCCTCCTCCTCCTCGTCATCGTCATCACCAGCACACACCCGA
GAGAAAAAAATCCTATAAAGAAATGGATTGAGCCATCACCCAACGCCGCCAAGATCCTGT
CCTCTTGTGTGCGCAACCTGTAGCTCCACCTCCACGCAGGATCAACACCCAAATCCCCCC
ATCTTCTTTTCTTTTTCGTTTCGTTTCTGCAAGATTTGCATCTTCTTCTTCTTCCTCCGA
GGAGTGAGTGACACCTGAGATAGCGAGAGCGAGATTTTCTTCGGTTTTTTTGTTCCTCTT
TTTGGCCATAAACCTCCCATAAAGCTCGGTTTCTTGGTTCGTTTTTTCTTTCTTTCTTCC
TCTCCTTCGAGAATCGCCCGAGTGTGAAATCCAAGATCCCGAATTCCGTGTCTTCTTCTT
CTTCCGTAGAAATCCCGGGGTGGGCAAAGCGGTGGGATTTCTGGAGAGGGGGAGAGCGCT
ACAAGGCAAGAAGCTTGGGTGTCCGTAGTCCGTACGGTTCTTGATCTGGGGTCGCCGCCA
ATGCAGCCGGACCCGAGCGGGAGCGGCGGCGACGGCAACGCCAATGCGAAGGCGAAGCTG
GCGCCGCCGCCGGTGACGGCGGCGGGAGGTCGGCCGGTGTCGGTGCTGCCGCACAAGACG
GCGAACGTGCGCGACCACTACCGCATCGGGAAGAAGCTCGGGCAGGGGCAGTTCGGGACG
ACGTACCTGTGCGTGGACAAGGCGAGCGGCGGCGAGTTCGCGTGCAAGTCCATCCCCAAG
CGGAAGCTGCTGTGCCGGGAGGACTACGAGGACGTGTGGCGCGAGATCCAGATCATGCAC
CACCTCTCCGAGCACCCCAACGTCGTCCGCATCCGCGGCGCCTACGAGGACGCGCTGTTC
GTCCACATCGTCATGGAGCTCTGCGCCGGCGGCGAGCTCTTCGACCGCATCGTCGCCAAG
GGCCACTACACCGAGCGCGCCGCCGCGCAGCTCATCCGCACCATCGTCGCCGTCGTCGAG
GGATGCCACTCGCTCGGCGTCATGCACCGGGACCTCAAGCCCGAGAACTTCCTCTTCGCC
AGCGCCGCCGAGGACGCCCCCCTCAAGGCCACTGATTTCGGCCTCTCCATGTTCTACAAG
CCTGGTGATAAGTTCTCTGATGTTGTTGGGAGCCCCTATTATGTTGCACCTGAGGTACTT
CAGAAATGCTATGGTCCAGAATCTGATGTCTGGAGTGCTGGGGTAATTCTTTACATTTTG
CTATGTGGTGTTCCACCATTTTGGGCAGAAACTGAAGCTGGAATTTTCAGGCAGATTCTA
CGAGGCAAACTTGATTTTGAATCTGAACCCTGGCCTAGCATCTCTGACAGTGCTAAAGAT
CTAGTCCGTAATATGCTTTGCCGGGATCCTACAAAGAGACTTACAGCCCATGAGGTTCTC
TGTCATCCATGGATTGTTGATGATGCTGTGGCACCTGACAAGCCTATTGATTCTGCTGTT
TTGTCAAGACTGAAGCACTTTTCGGCAATGAACAAGCTCAAGAAGATGGCATTGAGGGTT
ATTGCTGAAAGCCTGTCTGAGGAAGAGATTGGAGGACTAAAGGAGCTATTCAAAATGATT
GATACTGACGATAGTGGAACTATAACTTTTGATGAGCTGAAAGAGGGCTTGAAAAGGGTG
GGTTCAGAATTAACAGAACATGAAATCCAGGCTTTAATGGAAGCGGCTGATATCGACAAC
AGTGGAACCATCGACTATGGTGAATTCATTGCTGCTACTCTCCACATGAATAAGCTAGAG
AGGGAGGAAAACTTAGTATCAGCATTCTCATTTTTCGACAAAGATGGAAGTGGTTTCATA
ACTATTGATGAGCTGTCACAAGCATGCCGCGAATTTGGCCTTGATGATCTTCACCTTGAG
GATATGATTAAAGATGTTGATCAAAACAATGACGGACAAATTGACTACAGCGAGTTCACG
GCGATGATGAGAAAGGGCAATGCTGGTGGAGCTGGAAGGAGAACCATGAGGAACAGCTTG
CAGTTGAATCTTGGTGAGATCTTGAACCCCAGCAACAGCTAAACTCCTACAGGAAGGCCA
TGGCTGTTACATGCCATCATTGTCTGAATCTCTGCACGCCTCATCAGCTGGACTAATCTC
TAAGAGGGCAAAGCCGTTGAGTGAATTGTGCTTTGGCGTTACATGAGACGCTGAAGAATT
TTCGTAGCAGTAATAGCTACAGCTACTAGAGTGTAAGAGAAATTGGCGTTATGTGATCGT
AATATCCTATCAGTGTAACTGATCTTAGATGATGCTGGAGATGATAGTACAATGAACAGC
TTATATGTATTCCTGTCCTTGTAGACTGAACATTGTTGATAGTTGGGGAATGCTCTTGGC
ATC

CDS

1542 bp

>Os11t0171500-01 Calcium-dependent protein kinase
ATGCAGCCGGACCCGAGCGGGAGCGGCGGCGACGGCAACGCCAATGCGAAGGCGAAGCTG
GCGCCGCCGCCGGTGACGGCGGCGGGAGGTCGGCCGGTGTCGGTGCTGCCGCACAAGACG
GCGAACGTGCGCGACCACTACCGCATCGGGAAGAAGCTCGGGCAGGGGCAGTTCGGGACG
ACGTACCTGTGCGTGGACAAGGCGAGCGGCGGCGAGTTCGCGTGCAAGTCCATCCCCAAG
CGGAAGCTGCTGTGCCGGGAGGACTACGAGGACGTGTGGCGCGAGATCCAGATCATGCAC
CACCTCTCCGAGCACCCCAACGTCGTCCGCATCCGCGGCGCCTACGAGGACGCGCTGTTC
GTCCACATCGTCATGGAGCTCTGCGCCGGCGGCGAGCTCTTCGACCGCATCGTCGCCAAG
GGCCACTACACCGAGCGCGCCGCCGCGCAGCTCATCCGCACCATCGTCGCCGTCGTCGAG
GGATGCCACTCGCTCGGCGTCATGCACCGGGACCTCAAGCCCGAGAACTTCCTCTTCGCC
AGCGCCGCCGAGGACGCCCCCCTCAAGGCCACTGATTTCGGCCTCTCCATGTTCTACAAG
CCTGGTGATAAGTTCTCTGATGTTGTTGGGAGCCCCTATTATGTTGCACCTGAGGTACTT
CAGAAATGCTATGGTCCAGAATCTGATGTCTGGAGTGCTGGGGTAATTCTTTACATTTTG
CTATGTGGTGTTCCACCATTTTGGGCAGAAACTGAAGCTGGAATTTTCAGGCAGATTCTA
CGAGGCAAACTTGATTTTGAATCTGAACCCTGGCCTAGCATCTCTGACAGTGCTAAAGAT
CTAGTCCGTAATATGCTTTGCCGGGATCCTACAAAGAGACTTACAGCCCATGAGGTTCTC
TGTCATCCATGGATTGTTGATGATGCTGTGGCACCTGACAAGCCTATTGATTCTGCTGTT
TTGTCAAGACTGAAGCACTTTTCGGCAATGAACAAGCTCAAGAAGATGGCATTGAGGGTT
ATTGCTGAAAGCCTGTCTGAGGAAGAGATTGGAGGACTAAAGGAGCTATTCAAAATGATT
GATACTGACGATAGTGGAACTATAACTTTTGATGAGCTGAAAGAGGGCTTGAAAAGGGTG
GGTTCAGAATTAACAGAACATGAAATCCAGGCTTTAATGGAAGCGGCTGATATCGACAAC
AGTGGAACCATCGACTATGGTGAATTCATTGCTGCTACTCTCCACATGAATAAGCTAGAG
AGGGAGGAAAACTTAGTATCAGCATTCTCATTTTTCGACAAAGATGGAAGTGGTTTCATA
ACTATTGATGAGCTGTCACAAGCATGCCGCGAATTTGGCCTTGATGATCTTCACCTTGAG
GATATGATTAAAGATGTTGATCAAAACAATGACGGACAAATTGACTACAGCGAGTTCACG
GCGATGATGAGAAAGGGCAATGCTGGTGGAGCTGGAAGGAGAACCATGAGGAACAGCTTG
CAGTTGAATCTTGGTGAGATCTTGAACCCCAGCAACAGCTAA

Protein

513 aa

>Os11t0171500-01 Calcium-dependent protein kinase
MQPDPSGSGGDGNANAKAKLAPPPVTAAGGRPVSVLPHKTANVRDHYRIGKKLGQGQFGT
TYLCVDKASGGEFACKSIPKRKLLCREDYEDVWREIQIMHHLSEHPNVVRIRGAYEDALF
VHIVMELCAGGELFDRIVAKGHYTERAAAQLIRTIVAVVEGCHSLGVMHRDLKPENFLFA
SAAEDAPLKATDFGLSMFYKPGDKFSDVVGSPYYVAPEVLQKCYGPESDVWSAGVILYIL
LCGVPPFWAETEAGIFRQILRGKLDFESEPWPSISDSAKDLVRNMLCRDPTKRLTAHEVL
CHPWIVDDAVAPDKPIDSAVLSRLKHFSAMNKLKKMALRVIAESLSEEEIGGLKELFKMI
DTDDSGTITFDELKEGLKRVGSELTEHEIQALMEAADIDNSGTIDYGEFIAATLHMNKLE
REENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLEDMIKDVDQNNDGQIDYSEFT
AMMRKGNAGGAGRRTMRNSLQLNLGEILNPSNS*

5'UTR

chr11:3499345..3499934 (- strand) : 590 bp

chr11:3499185..3499254 (- strand) : 70 bp

CDS

chr11:3498581..3499184 (- strand) : 604 bp

chr11:3497480..3497623 (- strand) : 144 bp

chr11:3497241..3497393 (- strand) : 153 bp

chr11:3497015..3497130 (- strand) : 116 bp

chr11:3496290..3496457 (- strand) : 168 bp

chr11:3495816..3496040 (- strand) : 225 bp

chr11:3495598..3495729 (- strand) : 132 bp

3'UTR

chr11:3495277..3495597 (- strand) : 321 bp

FASTA

>Os11t0171500-01 class=Sequence position=chr11:3495277..3499934 (- strand)
ATAGATACGA CCTGGCTGCC CTCACAAAAA TACTTCACCA AACCACCCTC CTCCTCCTCC CCCTTTACCA TTTCCAAGTT
CCAACCCCCA AAAAAAATCC AACCAAAAAG CGGAGATTTT CCAACTCTTA TCATCTCCTC CTCCTCCTCC TCGTCATCGT
CATCACCAGC ACACACCCGA GAGAAAAAAA TCCTATAAAG AAATGGATTG AGCCATCACC CAACGCCGCC AAGATCCTGT
CCTCTTGTGT GCGCAACCTG TAGCTCCACC TCCACGCAGG ATCAACACCC AAATCCCCCC ATCTTCTTTT CTTTTTCGTT
TCGTTTCTGC AAGATTTGCA TCTTCTTCTT CTTCCTCCGA GGAGTGAGTG ACACCTGAGA TAGCGAGAGC GAGATTTTCT
TCGGTTTTTT TGTTCCTCTT TTTGGCCATA AACCTCCCAT AAAGCTCGGT TTCTTGGTTC GTTTTTTCTT TCTTTCTTCC
TCTCCTTCGA GAATCGCCCG AGTGTGAAAT CCAAGATCCC GAATTCCGTG TCTTCTTCTT CTTCCGTAGA AATCCCGGGG
TGGGCAAAGC GGTGGGATTT CTGGAGAGGG GTAAATGAGC TTCCGTTTCT CGATTGGTTC TTGATCGCGT CTCCTCTCTC
TCTCGAATTC ATTAGCTTCT CTTCGATTCT TTGATTTCAG GGAGAGCGCT ACAAGGCAAG AAGCTTGGGT GTCCGTAGTC
CGTACGGTTC TTGATCTGGG GTCGCCGCCA ATGCAGCCGG ACCCGAGCGG GAGCGGCGGC GACGGCAACG CCAATGCGAA
GGCGAAGCTG GCGCCGCCGC CGGTGACGGC GGCGGGAGGT CGGCCGGTGT CGGTGCTGCC GCACAAGACG GCGAACGTGC
GCGACCACTA CCGCATCGGG AAGAAGCTCG GGCAGGGGCA GTTCGGGACG ACGTACCTGT GCGTGGACAA GGCGAGCGGC
GGCGAGTTCG CGTGCAAGTC CATCCCCAAG CGGAAGCTGC TGTGCCGGGA GGACTACGAG GACGTGTGGC GCGAGATCCA
GATCATGCAC CACCTCTCCG AGCACCCCAA CGTCGTCCGC ATCCGCGGCG CCTACGAGGA CGCGCTGTTC GTCCACATCG
TCATGGAGCT CTGCGCCGGC GGCGAGCTCT TCGACCGCAT CGTCGCCAAG GGCCACTACA CCGAGCGCGC CGCCGCGCAG
CTCATCCGCA CCATCGTCGC CGTCGTCGAG GGATGCCACT CGCTCGGCGT CATGCACCGG GACCTCAAGC CCGAGAACTT
CCTCTTCGCC AGCGCCGCCG AGGACGCCCC CCTCAAGGCC ACTGATTTCG GCCTCTCCAT GTTCTACAAG CCTGGTATGT
GTGGTTTCTT AGTTTCACAT TTGCTCATTT TGGTAAGCAA TTCGTTGTTG TTATTGTTCA TGTGTTTGCA TTAAAATTGT
GTACTGCTTA TGTTGCATTC AAATGACTAA GTCGGAGCTT TGTTTATAGC TTGCCTTGGT TGAATCAATT AAGCTTAGTA
ATAGTTCTTT CATACATTGT TCATTTGGCT GTCTTCAGAT TAATTGAACT CAGCAATAGT TCTTGCATAC ATTGTTCATT
TTGCTGGAAG ACAGCTTACT TGTCTGCTAG ATTCTTACTT ACTTGTGGCC CATCTGTCCT TCTGTTACAC CCTGGTCTGC
ACTCATACAT TGGGTTTTGG GTTTGAATAA ATGAGGCTGA GATATGTGTG TGGTATGACA TTGATATGAT AATGGGAGAG
GGAATTGAAA CGTTCTTGGG TTCTAGCTGG AAACTCAATC TGTGCAAGTT AGTCCATTTT TGAGAAAAGG AATACCACAA
ACAGTTCCTA CATCCTAGTA CTAGTAACTT TGATGTAAAT GGCAATAGTA CTGCTTTTGT GGTTTATCTC ATTTGAACTT
TTTAATGCAT GTCAAATATT TTTTATGATA TTGTGATAGT TGCCAGCTGG TAATTTTCGC AAGGAACCAT TAAGTATTTA
AGTGCTCTTA TGATTACGTT ATGTAACCTT AAAATGGGTA GGGAAGAGGT ATCTTTGTCT CCATGTAGTC ACTATTCAGC
TAAGTCTAGT TCAATGGTAG TGTTATGTAT TGTTGGACAT GAGATTGGTT GCAAATTGCC TAATTTAGGA AGATGATGTG
AAATGCAGTG TCATACCTAC TGCTACCACC ATCGCCATTG TTGTTGTTCC TTATTTGTTT GTATCTGTAC TGTGTATTTT
GACTTGGATC TTGTCAGGAA TGCTGTATGA GTCATGTTAA GTTTATGAAA CTCTGATTTT CATTTCCTCA GGTGATAAGT
TCTCTGATGT TGTTGGGAGC CCCTATTATG TTGCACCTGA GGTACTTCAG AAATGCTATG GTCCAGAATC TGATGTCTGG
AGTGCTGGGG TAATTCTTTA CATTTTGCTA TGTGGTGTTC CACCATTTTG GGCAGGTAAA TTATTTGCCA CTAAACAACT
AAATTAGTAG GTCCCTCCAA ATTCTCACGT TTCCATTGTC ATATTGTCTC TTGCCTTGCA GAAACTGAAG CTGGAATTTT
CAGGCAGATT CTACGAGGCA AACTTGATTT TGAATCTGAA CCCTGGCCTA GCATCTCTGA CAGTGCTAAA GATCTAGTCC
GTAATATGCT TTGCCGGGAT CCTACAAAGA GACTTACAGC CCATGAGGTT CTCTGTAAGT CAACCCTGTT TCCTACTCTT
ACTCGCCATA GGTCTGCTTT GCTTAAATAT GACATAGGTA GGATGTCTTC TTTTTTCTCC TTGTGATGGC ATTGCCTATT
CCAGGTCATC CATGGATTGT TGATGATGCT GTGGCACCTG ACAAGCCTAT TGATTCTGCT GTTTTGTCAA GACTGAAGCA
CTTTTCGGCA ATGAACAAGC TCAAGAAGAT GGCATTGAGG GTACGGAGAT TTGTCTATAA GTTTGTGATT CAATTATTTG
CTTATTTCAA TTACTCTCAG GTTGACCTTG TTTGCCTCAT ATATGAAAGG CACCTGACAA GTCTCATTTT CTCCCCTGAT
TTGTTTGTAG GAAATGAATC TCACTGTTAA CTTCATTTAC TTATAAAAGT CTTGCATCTG TGGAATTCAA AAAATAATTA
AGTGTTGATA TATTCTACAA CCATGTGCAT TTTTAGTAGA GAGAGCTATC TGATCTCTTG AATCATGATG CCTCTTTTCA
TCCATTGACA CCACCTTTGT TTGAACCCAG GTTCATTTGG AATATATCCA GTAACTATTC TGTTCAGGTC AATGTTAACT
AAGATGATGT AGCAAACTGA TTCTTTCTGA CATTTGTTTG GGGCTACACG AAACCTGTTT CCTTGGCAGC CCAGACACTT
AATGCATTAT AGGCATCGTA GTTTTTCTTT TCTTTTGAAA TGCTCGATCT AGCTTGTGAA ACATGCAATG ATCATCTTGA
GCTCTTTACA TATTGTTAAG TATCTTTCAT TTTGCAGGTT ATTGCTGAAA GCCTGTCTGA GGAAGAGATT GGAGGACTAA
AGGAGCTATT CAAAATGATT GATACTGACG ATAGTGGAAC TATAACTTTT GATGAGCTGA AAGAGGGCTT GAAAAGGGTG
GGTTCAGAAT TAACAGAACA TGAAATCCAG GCTTTAATGG AAGCGGTAAG TGCTTCTTTG TTAGTTGATC CTTCAGGGAA
ATGTAACTTG CAGGGGCCTT CTGATCCTCA GCATTTTGTA TTTCTTGCAT GCTGTAATTT TTATGTCTCG TAATTTACAT
CTCGGCATCT CTCTTGCCTT TGCTAAAATG GAAAAGAAAA ATCCTTCACT AGGAAAGAAA GGTGTTTTGT ATTAAGATTT
AAGATAGCAT GTCTTGCTGC TTTTGCTAAA TTGTAATATG TTCATTTGTT TCAGGCTGAT ATCGACAACA GTGGAACCAT
CGACTATGGT GAATTCATTG CTGCTACTCT CCACATGAAT AAGCTAGAGA GGGAGGAAAA CTTAGTATCA GCATTCTCAT
TTTTCGACAA AGATGGAAGT GGTTTCATAA CTATTGATGA GCTGTCACAA GCATGCCGCG AATTTGGCCT TGATGATCTT
CACCTTGAGG ATATGATTAA AGATGTTGAT CAAAACAATG TGAGTTGTTC TTATACTCTG CATTCTGTAG TTTGTCCAAT
TTTTGACTTG TTTGTTCACC AATTGATTTC TTCACCCGTT TTCAGGACGG ACAAATTGAC TACAGCGAGT TCACGGCGAT
GATGAGAAAG GGCAATGCTG GTGGAGCTGG AAGGAGAACC ATGAGGAACA GCTTGCAGTT GAATCTTGGT GAGATCTTGA
ACCCCAGCAA CAGCTAAACT CCTACAGGAA GGCCATGGCT GTTACATGCC ATCATTGTCT GAATCTCTGC ACGCCTCATC
AGCTGGACTA ATCTCTAAGA GGGCAAAGCC GTTGAGTGAA TTGTGCTTTG GCGTTACATG AGACGCTGAA GAATTTTCGT
AGCAGTAATA GCTACAGCTA CTAGAGTGTA AGAGAAATTG GCGTTATGTG ATCGTAATAT CCTATCAGTG TAACTGATCT
TAGATGATGC TGGAGATGAT AGTACAATGA ACAGCTTATA TGTATTCCTG TCCTTGTAGA CTGAACATTG TTGATAGTTG
GGGAATGCTC TTGGCATC

Locus: Os11g0171500

Loading...

Locus: Os11g0171500

Loading...