Os11t0175400-01

Locus

Os11g0175400

Description

Plant neutral invertase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIN6

CGSNL Gene Name

NEUTRAL/ALKALINE INVERTASE 6

Oryzabase Gene Symbol Synonym(s)

OsNIN6

Oryzabase Gene Name Synonym(s)

neutral/alkaline invertase 6

Transcript Evidence

AK070884 (DDBJ, Best hit)

Protein Evidence

A7DVT6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Plant neutral invertase (IPR006937)

Six-hairpin glycosidase-like (IPR008928)

Full-length cDNA

J023068M15 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0175400-01)

RiceXPro (AK070884)

Others

Oryzabase (14671)

KEGG (Os11t0175400-01)

Transcript

2320 bp

>Os11t0175400-01 Plant neutral invertase family protein.
GGATAGTCTCCTCCCTCCACCACCACCACCTCCTTCCACGATCCCTCCCCCTCTTGATCC
CATCCGCCGCCGGAGGAGATCTTGCCGTTCTTGCGCTTGGATCTAGACCGCAAGATCGGT
GAACGGCGACGCTCTCATTGGTTGGTTTATTAGTTGGCTGGTTTCTCTCTCCTCGTCGAT
TCTTCTCCGGCGAACACGCCGCCGCCGCCGCTTCGGATTCAAGGATCTTGCATTGCCTGT
CTTTCCAATTTCACATTGGATTTACTCGAACTGATTCGTGCTGAAACAAATTTGACCAAG
AAAAGAAGAGGAGGTCATCAGCAGGATGAAGAGGGTGTCGTCCCACGTCTCCATCGCCTC
GGAGGCGGAGATCAACCTCGATCTCTCGCGGCTCCTCATCGACAAGCCGAGGCTGACGCT
GGAGAGGAAGAGGTCCTTCGACGAGCAGTCGTGGAGTGAGCTCTCCCACCGCCAGAACGA
CGGCTTCGACAGCATCATGCACTCCCCGGCGTTCCCCTCGGGCTTCGACTCGCCCTTCTC
GCTGGGGACGCTCGGTGATCCCCACCCGCTCGTGAACGAGGCGTGGGAGGCTCTCAGGAA
GTCCGTGGTGTACTTCCGGGGGCAGCCGGTTGGGACGATTGCCGCCGTCGACCATGCGTC
CGAGGAGGTGCTCAATTATGATCAGGTTTTTGTGCGAGATTTTTTTCCAAGTGCATTGGC
TTTTCTAATGAATAATGAGACTGATATAGTGAAAAACTTCCTCTTGAAAACACTCCACCT
GCAAAGCTCGGAGAAAATGGTAGACCGTTTCAAGCTTGGAGCAGGAGCGATGCCTGCAAG
TTTCAAGGTGGATCGTAATCGGAACAGAAACACTGAAACTTTAGTTGCAGATTTTGGTGA
GAGTGCAATTGGGAGGGTGGCTCCAGTGGACTCTGGATTTTGGTGGATTATTCTACTCCG
GGCATATACAAAGTATACGGCAGATACTAGTTTGGCAGAATCACCAGAGTGTCAGAACTG
CATGAGGCTGATACTGAACCTATGCTTATCTGAGGGATTTGATACCTTCCCAACTCTGCT
CTGCACAGATGGCTGCTCAATGATAGATCGTCGAATGGGTATATATGGTTATCCTATTGA
GATCCAAGCTCTATTCTACATGGCGTTGAGATGTGCTCTGCAGATGCTTAAGCCAGATGG
TGAAGGGAAGGATTTCATAGAAAAGATAGGGCAACGGCTACATGCTCTAACCTACCACAT
GAGGAATTACTTCTGGCTAGATTTCCCACACCTGAATAACATATACAGATATAAAACAGA
GGAGTATTCACACACTGCTGTGAACAAATTCAATGTCATCCCGGATTCAATCCCTGACTG
GGTGTTTGATTTCATGCCATGCCGGGGAGGCTACTTCCTTGGCAACGTGAGCCCAGCTAT
GATGGACTTTCGGTGGTTTGCCCTTGGAAATTGCATTGCCATTATATCATCTCTGGCTAC
TCCAGAGCAATCAGTGGCAATAATGGATCTGATTGAGGAGCGGTGGGAAGAGCTAGTTGG
TGAGATGCCTCTGAAGATATGTTACCCTGCAATTGAGAACCATGAATGGAGAATAATCAC
TGGCTGCGACCCGAAGAACACCCGGTGGAGTTATCACAATGGAGGATCATGGCCAGTTCT
CCTGTGGCTGCTGACAGCAGCCTGCATCAAGACTGGGCGTCCGCAGATGGCGAAGCGCGC
CATTGAGCTCGCCGAGTCCAGGCTACTGAAGGACGGCTGGCCAGAGTACTACGATGGCAA
GCTGGGACGGTTCATCGGCAAGCAGGCCAGGAAGTTCCAGACATGGTCCATCGCTGGCTA
CCTCGTAGCCCGTATGATGCTGGAGGACCCGTCGACGCTGATGATGATCTCCATGGAGGA
AGACCGGCCGGTGAAGCCGACCATGCGACGGTCAGCATCATGGAATGCCTGAAATGTTTT
GATAGAATTTTTTTTTCCCAAAGAGAGGTTCAATGTGGAAACTTATAGGAGTTTTGTCCA
AACATGAAAATGGGGTTCAAAATTTACTGTAACTGTACTGTCAGTTAGGACAGAAGTGTA
TACGATAGATCCAAGTCGTTTCAGAGCAATTTTGTCCAACTTTTCGTATCTGGCTTCATC
AATCCAACAGAGAAGAAGTTTTTGTTGGTGAAACATTTTTGCAATAATTAAACAGTTTTG
TCTTGACATATATACTAGCATATGTTTCTGTGATGGATAATTCTTTGTAATACTTTGTAG
GACTTTCTGTTAATATACTCCTCACATATTTTCATTGTGG

CDS

1647 bp

>Os11t0175400-01 Plant neutral invertase family protein.
ATGAAGAGGGTGTCGTCCCACGTCTCCATCGCCTCGGAGGCGGAGATCAACCTCGATCTC
TCGCGGCTCCTCATCGACAAGCCGAGGCTGACGCTGGAGAGGAAGAGGTCCTTCGACGAG
CAGTCGTGGAGTGAGCTCTCCCACCGCCAGAACGACGGCTTCGACAGCATCATGCACTCC
CCGGCGTTCCCCTCGGGCTTCGACTCGCCCTTCTCGCTGGGGACGCTCGGTGATCCCCAC
CCGCTCGTGAACGAGGCGTGGGAGGCTCTCAGGAAGTCCGTGGTGTACTTCCGGGGGCAG
CCGGTTGGGACGATTGCCGCCGTCGACCATGCGTCCGAGGAGGTGCTCAATTATGATCAG
GTTTTTGTGCGAGATTTTTTTCCAAGTGCATTGGCTTTTCTAATGAATAATGAGACTGAT
ATAGTGAAAAACTTCCTCTTGAAAACACTCCACCTGCAAAGCTCGGAGAAAATGGTAGAC
CGTTTCAAGCTTGGAGCAGGAGCGATGCCTGCAAGTTTCAAGGTGGATCGTAATCGGAAC
AGAAACACTGAAACTTTAGTTGCAGATTTTGGTGAGAGTGCAATTGGGAGGGTGGCTCCA
GTGGACTCTGGATTTTGGTGGATTATTCTACTCCGGGCATATACAAAGTATACGGCAGAT
ACTAGTTTGGCAGAATCACCAGAGTGTCAGAACTGCATGAGGCTGATACTGAACCTATGC
TTATCTGAGGGATTTGATACCTTCCCAACTCTGCTCTGCACAGATGGCTGCTCAATGATA
GATCGTCGAATGGGTATATATGGTTATCCTATTGAGATCCAAGCTCTATTCTACATGGCG
TTGAGATGTGCTCTGCAGATGCTTAAGCCAGATGGTGAAGGGAAGGATTTCATAGAAAAG
ATAGGGCAACGGCTACATGCTCTAACCTACCACATGAGGAATTACTTCTGGCTAGATTTC
CCACACCTGAATAACATATACAGATATAAAACAGAGGAGTATTCACACACTGCTGTGAAC
AAATTCAATGTCATCCCGGATTCAATCCCTGACTGGGTGTTTGATTTCATGCCATGCCGG
GGAGGCTACTTCCTTGGCAACGTGAGCCCAGCTATGATGGACTTTCGGTGGTTTGCCCTT
GGAAATTGCATTGCCATTATATCATCTCTGGCTACTCCAGAGCAATCAGTGGCAATAATG
GATCTGATTGAGGAGCGGTGGGAAGAGCTAGTTGGTGAGATGCCTCTGAAGATATGTTAC
CCTGCAATTGAGAACCATGAATGGAGAATAATCACTGGCTGCGACCCGAAGAACACCCGG
TGGAGTTATCACAATGGAGGATCATGGCCAGTTCTCCTGTGGCTGCTGACAGCAGCCTGC
ATCAAGACTGGGCGTCCGCAGATGGCGAAGCGCGCCATTGAGCTCGCCGAGTCCAGGCTA
CTGAAGGACGGCTGGCCAGAGTACTACGATGGCAAGCTGGGACGGTTCATCGGCAAGCAG
GCCAGGAAGTTCCAGACATGGTCCATCGCTGGCTACCTCGTAGCCCGTATGATGCTGGAG
GACCCGTCGACGCTGATGATGATCTCCATGGAGGAAGACCGGCCGGTGAAGCCGACCATG
CGACGGTCAGCATCATGGAATGCCTGA

Protein

549 aa

>Os11t0175400-01 Plant neutral invertase family protein.
MKRVSSHVSIASEAEINLDLSRLLIDKPRLTLERKRSFDEQSWSELSHRQNDGFDSIMHS
PAFPSGFDSPFSLGTLGDPHPLVNEAWEALRKSVVYFRGQPVGTIAAVDHASEEVLNYDQ
VFVRDFFPSALAFLMNNETDIVKNFLLKTLHLQSSEKMVDRFKLGAGAMPASFKVDRNRN
RNTETLVADFGESAIGRVAPVDSGFWWIILLRAYTKYTADTSLAESPECQNCMRLILNLC
LSEGFDTFPTLLCTDGCSMIDRRMGIYGYPIEIQALFYMALRCALQMLKPDGEGKDFIEK
IGQRLHALTYHMRNYFWLDFPHLNNIYRYKTEEYSHTAVNKFNVIPDSIPDWVFDFMPCR
GGYFLGNVSPAMMDFRWFALGNCIAIISSLATPEQSVAIMDLIEERWEELVGEMPLKICY
PAIENHEWRIITGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRPQMAKRAIELAESRL
LKDGWPEYYDGKLGRFIGKQARKFQTWSIAGYLVARMMLEDPSTLMMISMEEDRPVKPTM
RRSASWNA*

5'UTR

chr11:3743300..3743522 (- strand) : 223 bp

chr11:3743088..3743189 (- strand) : 102 bp

CDS

chr11:3742728..3743087 (- strand) : 360 bp

chr11:3741811..3742242 (- strand) : 432 bp

chr11:3740811..3741369 (- strand) : 559 bp

chr11:3739978..3740273 (- strand) : 296 bp

3'UTR

chr11:3739630..3739977 (- strand) : 348 bp

FASTA

>Os11t0175400-01 class=Sequence position=chr11:3739630..3743522 (- strand)
GGATAGTCTC CTCCCTCCAC CACCACCACC TCCTTCCACG ATCCCTCCCC CTCTTGATCC CATCCGCCGC CGGAGGAGAT
CTTGCCGTTC TTGCGCTTGG ATCTAGACCG CAAGATCGGT GAACGGCGAC GCTCTCATTG GTTGGTTTAT TAGTTGGCTG
GTTTCTCTCT CCTCGTCGAT TCTTCTCCGG CGAACACGCC GCCGCCGCCG CTTCGGATTC AAGGTATTCT TCTCTCCTCG
CCGGCCGCCG CCGCTGATTT TGCTACGGTC TTCGATTGAT TGCTTGCTGT CCGGTGTCAA ATCCGAATAT ATTCTTTCTT
GATTTCTTCT CAGGATCTTG CATTGCCTGT CTTTCCAATT TCACATTGGA TTTACTCGAA CTGATTCGTG CTGAAACAAA
TTTGACCAAG AAAAGAAGAG GAGGTCATCA GCAGGATGAA GAGGGTGTCG TCCCACGTCT CCATCGCCTC GGAGGCGGAG
ATCAACCTCG ATCTCTCGCG GCTCCTCATC GACAAGCCGA GGCTGACGCT GGAGAGGAAG AGGTCCTTCG ACGAGCAGTC
GTGGAGTGAG CTCTCCCACC GCCAGAACGA CGGCTTCGAC AGCATCATGC ACTCCCCGGC GTTCCCCTCG GGCTTCGACT
CGCCCTTCTC GCTGGGGACG CTCGGTGATC CCCACCCGCT CGTGAACGAG GCGTGGGAGG CTCTCAGGAA GTCCGTGGTG
TACTTCCGGG GGCAGCCGGT TGGGACGATT GCCGCCGTCG ACCATGCGTC CGAGGAGGTG CTCAATTATG ATCAGGTGAA
ATCGGAATCC TCTGCTTGTT CATATGGTTT CTGAAAACTG AATCTCGTTT TTATGTTCTT GTTGTATGAT GTATTGAATG
TTTGGTTTAT ACATGTTGAA ATCAGTACCT GAGTAATCTG GTGTGTTTAG GATCTTTGTA GTGTTTGATG CTTAGCCTTT
GTTTGATGTT GATATATATG ATTATGTCGA TTATCGAGCA ATATAATAGC TTTACTGAAT ATATTATGTA GGCTGTTAAA
TGGTAACTAT ATCCATCATC ACTGGCATGG AGTCCTGCAG AGCAAATTCG TTTGTTTTAC TAGCACTTAT GATGACCTGT
TCAGTTTGAT TATCTAAGCA GTATGGCTTT GAAAACTTTG CTTGCTTTCT AGCTAGGATT CTTCTGCATG CTTGTTTTTT
CAATGTTTTT TTCCCCCTGA ATCAAATGAA TAGTTCAGTT ATGCTTCACC TCTTTCCTGA TGTTATCCTT ACAATGGCAG
GTTTTTGTGC GAGATTTTTT TCCAAGTGCA TTGGCTTTTC TAATGAATAA TGAGACTGAT ATAGTGAAAA ACTTCCTCTT
GAAAACACTC CACCTGCAAA GCTCGGAGAA AATGGTAGAC CGTTTCAAGC TTGGAGCAGG AGCGATGCCT GCAAGTTTCA
AGGTGGATCG TAATCGGAAC AGAAACACTG AAACTTTAGT TGCAGATTTT GGTGAGAGTG CAATTGGGAG GGTGGCTCCA
GTGGACTCTG GATTTTGGTG GATTATTCTA CTCCGGGCAT ATACAAAGTA TACGGCAGAT ACTAGTTTGG CAGAATCACC
AGAGTGTCAG AACTGCATGA GGCTGATACT GAACCTATGC TTATCTGAGG GATTTGATAC CTTCCCAACT CTGCTCTGCA
CAGATGGCTG CTCAATGATA GATCGTCGAA TGGTATGAGC TTTCACCTTG ATTTGATTTA TTTCTTGACA TGTATCATTA
AAAACAGTAC AGTTCAGTTG ATGTGGCAAC AAAGAAGCTG AATGTTTCTG CTTTTTCTTC TTAGAACCAA GCAAGTTCTG
TTTTTTCAAA ACATTTTTTT AATAAAACGG GCAGAAATCT GATATTCAAA GCACAATGTC CGGGAGCACT GCATTGTTAT
TCCAAGTTTC AAGTATAAGC GTTGTCTTCT TAACCTTCTC TGAAAGAGAT ACTACGTAGT TTGAATTTAC TTAAAAATGG
ATAATAGTGC TAACAGGCAT TTGTAGTAGT ATAATACTAT AATCTCATTC CTAGAAGTTC TACTTTTTGA ACTACAATTT
TATAATTGGT GATTGAGATC CTTATCATTA CATGACTGTT TGGCTCAAAT GTTAAATCTA CTATTATTTC CAGGGTATAT
ATGGTTATCC TATTGAGATC CAAGCTCTAT TCTACATGGC GTTGAGATGT GCTCTGCAGA TGCTTAAGCC AGATGGTGAA
GGGAAGGATT TCATAGAAAA GATAGGGCAA CGGCTACATG CTCTAACCTA CCACATGAGG AATTACTTCT GGCTAGATTT
CCCACACCTG AATAACATAT ACAGATATAA AACAGAGGAG TATTCACACA CTGCTGTGAA CAAATTCAAT GTCATCCCGG
ATTCAATCCC TGACTGGGTG TTTGATTTCA TGCCATGCCG GGGAGGCTAC TTCCTTGGCA ACGTGAGCCC AGCTATGATG
GACTTTCGGT GGTTTGCCCT TGGAAATTGC ATTGCCATTA TATCATCTCT GGCTACTCCA GAGCAATCAG TGGCAATAAT
GGATCTGATT GAGGAGCGGT GGGAAGAGCT AGTTGGTGAG ATGCCTCTGA AGATATGTTA CCCTGCAATT GAGAACCATG
AATGGAGAAT AATCACTGGC TGCGACCCGA AGAACACCCG GTGGAGTTAT CACAATGGAG GATCATGGCC AGGTTAAAGT
TTTCCTTTTG CACTGTGCTA ACTTGAGATG ATTCTGTTGC TGATCCTTAC TATGCATTAC TCTTCATAAA AATTAGTCAT
GTCCAATATT ATGGCTGATA GCTTAGATGT CAATTCATCA CACACAATAA TAAATAGGTA AACTAAAGTT TATTCTGAAA
TCGATCACAT AATACTATTC AACATTCACC TCTTCTGATA ATGACTTTGT TCTAATAATT TTTATTAATC AAGTCTTATA
CTGTAAGATC CTTAATGTCA TACAGAAGCT GTAAAAACTA ACTTTTTGGG GGTAGCTAAG GTGCTTATGG CTATGAAATT
TTGACTTCTT CATCTGTTTT CATCAAATTG AACAGAACCG ACAGATCCCT TTGAGGGTTG AGTGTGGCAC TTTTTTTTTT
CCTAAAGTTG ATCCGATCTT CGTGTTCCCT AGATAGTTGG CGAAATGTGA TTCTGATGTT CACAACCAAA GTCACCTGAA
TCCTCATTCC AAGATCTTAA CGTTTATGTG TGTGTTCTCC CATCTGCAGT TCTCCTGTGG CTGCTGACAG CAGCCTGCAT
CAAGACTGGG CGTCCGCAGA TGGCGAAGCG CGCCATTGAG CTCGCCGAGT CCAGGCTACT GAAGGACGGC TGGCCAGAGT
ACTACGATGG CAAGCTGGGA CGGTTCATCG GCAAGCAGGC CAGGAAGTTC CAGACATGGT CCATCGCTGG CTACCTCGTA
GCCCGTATGA TGCTGGAGGA CCCGTCGACG CTGATGATGA TCTCCATGGA GGAAGACCGG CCGGTGAAGC CGACCATGCG
ACGGTCAGCA TCATGGAATG CCTGAAATGT TTTGATAGAA TTTTTTTTTC CCAAAGAGAG GTTCAATGTG GAAACTTATA
GGAGTTTTGT CCAAACATGA AAATGGGGTT CAAAATTTAC TGTAACTGTA CTGTCAGTTA GGACAGAAGT GTATACGATA
GATCCAAGTC GTTTCAGAGC AATTTTGTCC AACTTTTCGT ATCTGGCTTC ATCAATCCAA CAGAGAAGAA GTTTTTGTTG
GTGAAACATT TTTGCAATAA TTAAACAGTT TTGTCTTGAC ATATATACTA GCATATGTTT CTGTGATGGA TAATTCTTTG
TAATACTTTG TAGGACTTTC TGTTAATATA CTCCTCACAT ATTTTCATTG TGG

Locus: Os11g0175400

Loading...

Locus: Os11g0175400

Loading...