Os11t0184800-01

Locus

Os11g0184800

Description

Nucellin-like protein, Aspartic protease 1, Regulation of distinct caryopses development in different branches, Negative regulation of transcriptional inhibitor of auxin biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsAsp1

RAP-DB Gene Name Synonym(s)

aspartic protease 1

CGSNL Gene Symbol

ASP1

CGSNL Gene Name

ASPARTIC PROTEASE 1

Oryzabase Gene Symbol Synonym(s)

OsAsp1

Oryzabase Gene Name Synonym(s)

aspartic protease 1

Transcript Evidence

AK110811

Protein Evidence

Q0IU52

Literature

PMID: 33108367

Note

Manual Curation

October 28, 2020

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: aspartic-type endopeptidase activity (GO:0004190)

Functional domain (InterPro)

Aspartic peptidase domain superfamily (IPR021109)

Xylanase inhibitor, N-terminal (IPR032861)

Peptidase family A1 domain (IPR033121)

Xylanase inhibitor, C-terminal (IPR032799)

Aspartic peptidase, active site (IPR001969)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783)

Full-length cDNA

002-171-F05 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0184800-01)

RiceXPro (AK110811)

Others

Oryzabase (12553)

KEGG (Os11t0184800-01)

Transcript

1463 bp

>Os11t0184800-01 Nucellin-like protein, Aspartic protease 1, Regulation of distinct caryopses development in different branches, Negative regulation of transcriptional inhibitor of auxin biosynthesis
ACTCAAACCATCCCAATGAACAGAGTTTCAAAAGAGAAAGAAGTATAGCCCTTCAGGCTG
TCACAGCACTTGTGTCTAAGAGCTCCACCTCCATCACACCATGACTGCAAGGTTGGCACT
GCTCGCCAGCCTTCTTCTCCTGCTCCAACTGGTGCCGCCATCCTCTGCCGTGGTGTTGGA
GCTCCACGGTAACGTCTACCCTATTGGCCATTTCTTCATCACCATGAACATCGGCGACCC
GGCAAAATCCTACTTCCTGGACATCGACACCGGCAGCACCCTCACCTGGCTGCAGTGCGA
CGCCCCCTGCACGAATTGCAACATTGTACCACACGTGCTGTACAAGCCAACCCCAAAGAA
GCTGGTGACCTGTGCCGACTCACTCTGCACTGACCTGTACACTGATCTGGGCAAGCCCAA
GAGATGTGGATCCCAGAAGCAATGTGACTATGTGATTCAGTACGTCGACAGTTCATCCAT
GGGCGTGCTCGTCATCGACAGGTTCTCCCTCTCAGCAAGCAACGGCACCAATCCTACTAC
CATAGCCTTCGGCTGTGGGTACGACCAGGGGAAGAAGAATCGCAATGTGCCCATACCGGT
AGACAGCATCCTCGGGCTCAGTAGAGGCAAGGTTACGCTGCTCTCGCAGCTCAAGTCCCA
GGGGGTGATCACCAAACATGTCTTGGGCCATTGCATCAGCTCAAAAGGTGGGGGTTTCCT
CTTCTTTGGGGATGCCCAGGTGCCAACTTCAGGTGTAACCTGGACCCCCATGAACAGAGA
ACATAAGTACTACTCTCCTGGGCATGGAACCTTGCACTTCGATTCAAATAGCAAGGCGAT
AAGCGCGGCACCAATGGCAGTGATATTTGACAGTGGTGCCACATACACCTACTTTGCTGC
GCAGCCATACCAAGCGACTCTCTCAGTGGTGAAATCCACTCTCAACAGCGAATGTAAGTT
TCTTACCGAGGTGACAGAAAAAGATCGGGCTCTTACTGTATGCTGGAAAGGGAAGGATAA
AATCGTAACTATCGATGAAGTCAAGAAGTGCTTCAGATCACTGTCTCTGGAATTCGCCGA
TGGCGATAAGAAGGCCACTTTGGAGATCCCACCTGAGCACTACCTCATTATCTCTCAAGA
GGGCCATGTGTGCTTGGGCATCCTTGATGGATCGAAGGAGCATCTGTCGTTAGCTGGAAC
AAACTTAATTGGAGGAATTACAATGCTGGATCAGATGGTCATATATGACAGCGAGAGATC
GCTGCTCGGATGGGTCAATTATCAGTGCGATAGAATTCCCCGTTCTGAGTCTGCGATCAC
TTCGCGTCTCTGAATGAACTGAAAACCAGAATACAGGGAGGATAGATGGAAACAGAAAGG
GACATTCATATCTTAGAAAAGAAATGAATGATAAAGCATGTATGCTTCTGCCCATAAATA
ATGAAATGAAGTAATATTTTAGC

CDS

1233 bp

>Os11t0184800-01 Nucellin-like protein, Aspartic protease 1, Regulation of distinct caryopses development in different branches, Negative regulation of transcriptional inhibitor of auxin biosynthesis
ATGACTGCAAGGTTGGCACTGCTCGCCAGCCTTCTTCTCCTGCTCCAACTGGTGCCGCCA
TCCTCTGCCGTGGTGTTGGAGCTCCACGGTAACGTCTACCCTATTGGCCATTTCTTCATC
ACCATGAACATCGGCGACCCGGCAAAATCCTACTTCCTGGACATCGACACCGGCAGCACC
CTCACCTGGCTGCAGTGCGACGCCCCCTGCACGAATTGCAACATTGTACCACACGTGCTG
TACAAGCCAACCCCAAAGAAGCTGGTGACCTGTGCCGACTCACTCTGCACTGACCTGTAC
ACTGATCTGGGCAAGCCCAAGAGATGTGGATCCCAGAAGCAATGTGACTATGTGATTCAG
TACGTCGACAGTTCATCCATGGGCGTGCTCGTCATCGACAGGTTCTCCCTCTCAGCAAGC
AACGGCACCAATCCTACTACCATAGCCTTCGGCTGTGGGTACGACCAGGGGAAGAAGAAT
CGCAATGTGCCCATACCGGTAGACAGCATCCTCGGGCTCAGTAGAGGCAAGGTTACGCTG
CTCTCGCAGCTCAAGTCCCAGGGGGTGATCACCAAACATGTCTTGGGCCATTGCATCAGC
TCAAAAGGTGGGGGTTTCCTCTTCTTTGGGGATGCCCAGGTGCCAACTTCAGGTGTAACC
TGGACCCCCATGAACAGAGAACATAAGTACTACTCTCCTGGGCATGGAACCTTGCACTTC
GATTCAAATAGCAAGGCGATAAGCGCGGCACCAATGGCAGTGATATTTGACAGTGGTGCC
ACATACACCTACTTTGCTGCGCAGCCATACCAAGCGACTCTCTCAGTGGTGAAATCCACT
CTCAACAGCGAATGTAAGTTTCTTACCGAGGTGACAGAAAAAGATCGGGCTCTTACTGTA
TGCTGGAAAGGGAAGGATAAAATCGTAACTATCGATGAAGTCAAGAAGTGCTTCAGATCA
CTGTCTCTGGAATTCGCCGATGGCGATAAGAAGGCCACTTTGGAGATCCCACCTGAGCAC
TACCTCATTATCTCTCAAGAGGGCCATGTGTGCTTGGGCATCCTTGATGGATCGAAGGAG
CATCTGTCGTTAGCTGGAACAAACTTAATTGGAGGAATTACAATGCTGGATCAGATGGTC
ATATATGACAGCGAGAGATCGCTGCTCGGATGGGTCAATTATCAGTGCGATAGAATTCCC
CGTTCTGAGTCTGCGATCACTTCGCGTCTCTGA

Protein

411 aa

>Os11t0184800-01 Nucellin-like protein, Aspartic protease 1, Regulation of distinct caryopses development in different branches, Negative regulation of transcriptional inhibitor of auxin biosynthesis
MTARLALLASLLLLLQLVPPSSAVVLELHGNVYPIGHFFITMNIGDPAKSYFLDIDTGST
LTWLQCDAPCTNCNIVPHVLYKPTPKKLVTCADSLCTDLYTDLGKPKRCGSQKQCDYVIQ
YVDSSSMGVLVIDRFSLSASNGTNPTTIAFGCGYDQGKKNRNVPIPVDSILGLSRGKVTL
LSQLKSQGVITKHVLGHCISSKGGGFLFFGDAQVPTSGVTWTPMNREHKYYSPGHGTLHF
DSNSKAISAAPMAVIFDSGATYTYFAAQPYQATLSVVKSTLNSECKFLTEVTEKDRALTV
CWKGKDKIVTIDEVKKCFRSLSLEFADGDKKATLEIPPEHYLIISQEGHVCLGILDGSKE
HLSLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDRIPRSESAITSRL*

5'UTR

chr11:4295162..4295261 (+ strand) : 100 bp

CDS

chr11:4295262..4295368 (+ strand) : 107 bp

chr11:4295458..4295575 (+ strand) : 118 bp

chr11:4295762..4295988 (+ strand) : 227 bp

chr11:4296107..4296331 (+ strand) : 225 bp

chr11:4296504..4296654 (+ strand) : 151 bp

chr11:4296741..4296947 (+ strand) : 207 bp

chr11:4297044..4297122 (+ strand) : 79 bp

chr11:4297207..4297325 (+ strand) : 119 bp

3'UTR

chr11:4297326..4297455 (+ strand) : 130 bp

FASTA

>Os11t0184800-01 class=Sequence position=chr11:4295162..4297455 (+ strand)
ACTCAAACCA TCCCAATGAA CAGAGTTTCA AAAGAGAAAG AAGTATAGCC CTTCAGGCTG TCACAGCACT TGTGTCTAAG
AGCTCCACCT CCATCACACC ATGACTGCAA GGTTGGCACT GCTCGCCAGC CTTCTTCTCC TGCTCCAACT GGTGCCGCCA
TCCTCTGCCG TGGTGTTGGA GCTCCACGGT AACGTCTACC CTATTGGGTA AGCAAACCTT CTTTCCAGAG AACCCATCAA
CGTTTTGTGT GTCCAATGTT CAGTGCAATG TTTGACATTT TTGTTGTTCT CTGCAGCCAT TTCTTCATCA CCATGAACAT
CGGCGACCCG GCAAAATCCT ACTTCCTGGA CATCGACACC GGCAGCACCC TCACCTGGCT GCAGTGCGAC GCCCCCTGCA
CGAATTGCAA CATTGTACAC TCACGTGCCA TATTTTTAGA TCAAGCATAG AAAACCTCTT TGAATTCATG TCCTTGATTC
GCTTCTACTC ACATTCAGAA TAGGGCCAAA ATGAGCAATC TTCAATGCAA CCATGTCGTT TTGGTTTCAG TGCATCTATT
GATGAGTTCT TTTTTTGTCA ACCTTTTCTA ATCAACACAG GTACCACACG TGCTGTACAA GCCAACCCCA AAGAAGCTGG
TGACCTGTGC CGACTCACTC TGCACTGACC TGTACACTGA TCTGGGCAAG CCCAAGAGAT GTGGATCCCA GAAGCAATGT
GACTATGTGA TTCAGTACGT CGACAGTTCA TCCATGGGCG TGCTCGTCAT CGACAGGTTC TCCCTCTCAG CAAGCAACGG
CACCAATCCT ACTACCATAG CCTTCGGGTA AGCCACCACA AGTCGAAACA TTATGCATTT GCATGATATG TCAGTATAGT
GACACACACC GGCGATGACG GTGATGACTG ACTACCCTCT CTTGCTTGCT TGCTTGCTCA TGTAGCTGTG GGTACGACCA
GGGGAAGAAG AATCGCAATG TGCCCATACC GGTAGACAGC ATCCTCGGGC TCAGTAGAGG CAAGGTTACG CTGCTCTCGC
AGCTCAAGTC CCAGGGGGTG ATCACCAAAC ATGTCTTGGG CCATTGCATC AGCTCAAAAG GTGGGGGTTT CCTCTTCTTT
GGGGATGCCC AGGTGCCAAC TTCAGGTGTA ACCTGGACCC CCATGAACAG GTAGGCACTG TTGCCCGTCA AGAGCTTGTC
GGTGAAAACT ATTTGACAAA GTTGGCTTCA CGTAACGATA ACCCGCAAAG TTAGAGATGG ATATGATTGA GCTTTTAGTA
TCCTTTTGTA AGTCAATTTG ACATGGTATT ACATATTTAC ATGGCATTGT GTTTTGTTCC AGAGAACATA AGTACTACTC
TCCTGGGCAT GGAACCTTGC ACTTCGATTC AAATAGCAAG GCGATAAGCG CGGCACCAAT GGCAGTGATA TTTGACAGTG
GTGCCACATA CACCTACTTT GCTGCGCAGC CATACCAAGC GACTCTCTCA GTGGTATGCA CACTTGCCTT TTATATTCGT
ATGCCAATAT ATCTGAGCAG AGAACATCCA GGGAAACTCA TGTCATGTCA TACTTGCAGG TGAAATCCAC TCTCAACAGC
GAATGTAAGT TTCTTACCGA GGTGACAGAA AAAGATCGGG CTCTTACTGT ATGCTGGAAA GGGAAGGATA AAATCGTAAC
TATCGATGAA GTCAAGAAGT GCTTCAGATC ACTGTCTCTG GAATTCGCCG ATGGCGATAA GAAGGCCACT TTGGAGATCC
CACCTGAGCA CTACCTCATT ATCTCTGTAA GCATTCAACA ACTCAAATTA CGATACAAGC TAGTAATGGA CAACAAATCA
TTGAAGGAAC AACAACTAAC ATCCTTTGTG TGTTTGTGGC AGCAAGAGGG CCATGTGTGC TTGGGCATCC TTGATGGATC
GAAGGAGCAT CTGTCGTTAG CTGGAACAAA CTTAATTGGA GGTATGAAGT TCAGACATTC AAACATGCTC ACCACCATAT
GCATAATCTT TGTAATTAAC ATTTCGATTG ATTACTGTTC TACAGGAATT ACAATGCTGG ATCAGATGGT CATATATGAC
AGCGAGAGAT CGCTGCTCGG ATGGGTCAAT TATCAGTGCG ATAGAATTCC CCGTTCTGAG TCTGCGATCA CTTCGCGTCT
CTGAATGAAC TGAAAACCAG AATACAGGGA GGATAGATGG AAACAGAAAG GGACATTCAT ATCTTAGAAA AGAAATGAAT
GATAAAGCAT GTATGCTTCT GCCCATAAAT AATGAAATGA AGTAATATTT TAGC

Locus: Os11g0184800

Loading...

Locus: Os11g0184800

Loading...