Os11t0186200-01

Locus

Os11g0186200

Description

Similar to Aldehyde dehydrogenase (EC 1.2.1.3).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH3H2

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 3H2

Oryzabase Gene Symbol Synonym(s)

OsALDH3H2

Oryzabase Gene Name Synonym(s)

Aldehyde dehydrogenase 3H2

Transcript Evidence

AK104603 (DDBJ, Best hit)

AK104746 (DDBJ, Best hit)

Protein Evidence

B8BJI2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellular aldehyde metabolic process (GO:0006081)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: aldehyde dehydrogenase [NAD(P)+] activity (GO:0004030)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase NAD(P)-dependent (IPR012394)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

006-308-H06 (Online Clone Ordering)

001-038-E07 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0186200-01)

RiceXPro (AK104603)

Others

Oryzabase (22114)

KEGG (Os11t0186200-01 (EC:1.2.1.3))

Transcript

1720 bp

>Os11t0186200-01 Similar to Aldehyde dehydrogenase (EC 1.2.1.3).
GGCTGCTTCCTCCTGACTCCTCTCCTGCATTCTCTCGCTTCTGACGGCGGCAACTAAGCT
TTTTGGGATTCGATTCGAGGAGGAGGTGATGGCGGAGGAGGAGGTGGCGGCGGTGGTGGG
GGAGCTGAGGGGGAGCTTCAGGTCCGGGAGGACGAGGGCGGCGGAGTGGCGGGCGGCGCA
GCTGCGGGGGATCGTGAGGATGGTGGAGGAGAGGGAGGGGGACATCTCCGACGCGCTCCA
CTCCGACCTCGCCAAGCCTCGCATGGAGTCCTACCTCCACGAGATATCATTGGCAAAGGC
AGCCTGCACATTTGCCTTGAAGGGGTTGAAGAATTGGATGAAACCTGAGAAGGTACCTGC
CGCCCTCACTACATTCCCATCAACTGCACAAATTGTGTCAGAGCCTCTTGGTGTCGTCCT
AGTCATCTCAGCATGGAACTACCCTTTCTTGCTCTCCATCGACCCAGTCATAGGAGCAAT
TGCTGCTGGGAATGCCGTTGTGCTGAAGCCATCAGAAATTGCACCAGCCACCTCAGCATT
GTTCGCCAAGCTGCTACCTGAATACGTTGATAGCTCTTGCATAAAAGTGGTGGAGGGAGG
CGTTCCAGAAACAACCGCACTCTTAGAACAAAAGTGGGATAAGATCTTCTACACAGGTAG
CGGAAATGTGGGCCGCATAGTGATGGCAGCAGCTGCAAAGCATCTTACCCCTGTGGCTCT
AGAGCTTGGTGGAAAATGCCCTGCAATTGTTGATTCTAATACTGATCTTCATGTTACCAT
GAAGAGGCTAGCTGTTGGCAAGTGGGGATGTAACAACGGGCAGGCATGCATTGCTCCAGA
CTACGTTATAACAACAAAATCATTTGCTCCAGAGCTGGTTGACTCTTTAAAAAGAGTTTT
GAAAAGGTTCTATGGGGAGGATCCTTTGCAATCAGAAGACTTGTCCCGTATTGTGAATTC
TAACCATTTCCGTAGATTGACAAATTTGATAGAGGATAAGAAAGTCGCCCAAAAGATTGT
ATATGGTGGCCAAACAGATGAGAAGCAACTAAAAATAGCTCCTACTGTGTTGTTAGATGT
TCCTCTTGATACAACACTCATGGCAGAGGAAATTTTTGGTCCCTTACTTCCCATTGTAAC
AGTTGACAAGATTGAAGATAGCATCCAGTTCATCAACTCAAGGACCAAGCCACTTGCAGC
CTATCTTTTCACCAAGGACAAGAAACTGCAAGAGGAATTTGTGTCCAATGTCCCAGCAGG
AGGAATGCTTGTAAATGATGTTGCCCTGCATCTCGCCAATCCGCACCTGCCATTTGGCGG
AGTCGGCGACAGCGGGATCGGCTCCTACCATGGCAAATTCAGCTTCGATTGTTTCACCCA
CAAGAAGGCCGTCCTGATCCGCGGCTTCGGAGGGGAGGCAACTGCTAGGTACCCACCTTA
CACGATTGAGAAGCAGAAGATCCTGAGAGGACTGATAAACGGCAGCTTCTTTGCACTGAT
TCTTGCCCTCCTGGGCTTCCCCAAAGAGAGGCGTTAGAAAACTTTCAGTAGTTTCAGTAC
AGTACTTGTGCATTTGAGTGAGTGCAGGCCATGCTGTCAATGGAAGCCATTTCCTGCATG
TTGTTTTACACAGGTGTACATTATATTTGTCGGATTTTCTTGTGTAACTTATTGAAAATT
CTACTACACAGGGTTACATAAATAAACATGATTTGTCAGT

CDS

1449 bp

>Os11t0186200-01 Similar to Aldehyde dehydrogenase (EC 1.2.1.3).
ATGGCGGAGGAGGAGGTGGCGGCGGTGGTGGGGGAGCTGAGGGGGAGCTTCAGGTCCGGG
AGGACGAGGGCGGCGGAGTGGCGGGCGGCGCAGCTGCGGGGGATCGTGAGGATGGTGGAG
GAGAGGGAGGGGGACATCTCCGACGCGCTCCACTCCGACCTCGCCAAGCCTCGCATGGAG
TCCTACCTCCACGAGATATCATTGGCAAAGGCAGCCTGCACATTTGCCTTGAAGGGGTTG
AAGAATTGGATGAAACCTGAGAAGGTACCTGCCGCCCTCACTACATTCCCATCAACTGCA
CAAATTGTGTCAGAGCCTCTTGGTGTCGTCCTAGTCATCTCAGCATGGAACTACCCTTTC
TTGCTCTCCATCGACCCAGTCATAGGAGCAATTGCTGCTGGGAATGCCGTTGTGCTGAAG
CCATCAGAAATTGCACCAGCCACCTCAGCATTGTTCGCCAAGCTGCTACCTGAATACGTT
GATAGCTCTTGCATAAAAGTGGTGGAGGGAGGCGTTCCAGAAACAACCGCACTCTTAGAA
CAAAAGTGGGATAAGATCTTCTACACAGGTAGCGGAAATGTGGGCCGCATAGTGATGGCA
GCAGCTGCAAAGCATCTTACCCCTGTGGCTCTAGAGCTTGGTGGAAAATGCCCTGCAATT
GTTGATTCTAATACTGATCTTCATGTTACCATGAAGAGGCTAGCTGTTGGCAAGTGGGGA
TGTAACAACGGGCAGGCATGCATTGCTCCAGACTACGTTATAACAACAAAATCATTTGCT
CCAGAGCTGGTTGACTCTTTAAAAAGAGTTTTGAAAAGGTTCTATGGGGAGGATCCTTTG
CAATCAGAAGACTTGTCCCGTATTGTGAATTCTAACCATTTCCGTAGATTGACAAATTTG
ATAGAGGATAAGAAAGTCGCCCAAAAGATTGTATATGGTGGCCAAACAGATGAGAAGCAA
CTAAAAATAGCTCCTACTGTGTTGTTAGATGTTCCTCTTGATACAACACTCATGGCAGAG
GAAATTTTTGGTCCCTTACTTCCCATTGTAACAGTTGACAAGATTGAAGATAGCATCCAG
TTCATCAACTCAAGGACCAAGCCACTTGCAGCCTATCTTTTCACCAAGGACAAGAAACTG
CAAGAGGAATTTGTGTCCAATGTCCCAGCAGGAGGAATGCTTGTAAATGATGTTGCCCTG
CATCTCGCCAATCCGCACCTGCCATTTGGCGGAGTCGGCGACAGCGGGATCGGCTCCTAC
CATGGCAAATTCAGCTTCGATTGTTTCACCCACAAGAAGGCCGTCCTGATCCGCGGCTTC
GGAGGGGAGGCAACTGCTAGGTACCCACCTTACACGATTGAGAAGCAGAAGATCCTGAGA
GGACTGATAAACGGCAGCTTCTTTGCACTGATTCTTGCCCTCCTGGGCTTCCCCAAAGAG
AGGCGTTAG

Protein

483 aa

>Os11t0186200-01 Similar to Aldehyde dehydrogenase (EC 1.2.1.3).
MAEEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRME
SYLHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPF
LLSIDPVIGAIAAGNAVVLKPSEIAPATSALFAKLLPEYVDSSCIKVVEGGVPETTALLE
QKWDKIFYTGSGNVGRIVMAAAAKHLTPVALELGGKCPAIVDSNTDLHVTMKRLAVGKWG
CNNGQACIAPDYVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRLTNL
IEDKKVAQKIVYGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIEDSIQ
FINSRTKPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSY
HGKFSFDCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGFPKE
RR*

5'UTR

chr11:4375371..4375458 (+ strand) : 88 bp

CDS

chr11:4375459..4375653 (+ strand) : 195 bp

chr11:4376889..4376957 (+ strand) : 69 bp

chr11:4377067..4377163 (+ strand) : 97 bp

chr11:4377850..4378056 (+ strand) : 207 bp

chr11:4378203..4378318 (+ strand) : 116 bp

chr11:4378416..4378520 (+ strand) : 105 bp

chr11:4378610..4378782 (+ strand) : 173 bp

chr11:4378875..4378965 (+ strand) : 91 bp

chr11:4379284..4379433 (+ strand) : 150 bp

chr11:4379530..4379775 (+ strand) : 246 bp

3'UTR

chr11:4379776..4379958 (+ strand) : 183 bp

FASTA

>Os11t0186200-01 class=Sequence position=chr11:4375371..4379958 (+ strand)
GGCTGCTTCC TCCTGACTCC TCTCCTGCAT TCTCTCGCTT CTGACGGCGG CAACTAAGCT TTTTGGGATT CGATTCGAGG
AGGAGGTGAT GGCGGAGGAG GAGGTGGCGG CGGTGGTGGG GGAGCTGAGG GGGAGCTTCA GGTCCGGGAG GACGAGGGCG
GCGGAGTGGC GGGCGGCGCA GCTGCGGGGG ATCGTGAGGA TGGTGGAGGA GAGGGAGGGG GACATCTCCG ACGCGCTCCA
CTCCGACCTC GCCAAGCCTC GCATGGAGTC CTACCTCCAC GAGGTGAGCG CCGCCTTTGT TGTTCTTTCT CTCCATGGAG
AATTCGATGA TGAGATTGGG ATAGGATAGG ATAGGATTGA ACTTTACTTT TTTCTGCTCT GTTTGAACTT TGTTTTTCGT
GGCCAAGATT GTTGGGATTG GCAAGAACTG CAAACTTGGG GGTTGATTCT TTGATTCTGA TTTCGTCTTG GCTGAAAGTA
GAATCAGATA TTTCATCTTG ACTGGAAAGA AATTTAGTTC TGAAAGTAAA ATTAGTTTTT GATGATTATA TTCAGAGCCC
AGATTGCTGC TGTGTAGATC GAGGTGATTT TGAGTTAAAA TTAATTTTTC TTTGGCGTTT TGAGAGGTGA TTGAAGTAAA
ATTAAATTTC TTTGGTGTTT TGAGGCGATG ATTGGAGTAG AATTAAATTT CTTTTTTGGT GCTGGATAGA TCGAGGTGAT
GTGTTGTTGA ACACTCGCTG CTGCTGCTGC TGTTTTTTCT GGTGGTGTCC ACTGCTTTTT GGGAAAGTAG CGATTCTCTC
TAGTCGTATC TTTTCATGTG CGCTTGACGC ATACAAATGT TGAAATCGTT GCGTGCTCCG CTAATTTAGT GGTGGTCAAA
CACTCCACAC CGGCGTTGCT TCCACGAATT CCTCCCTCCG TTTGGTCCCA GATTGGTAGA CGTTCTTGTC AGATTATTTT
TATTATTATT GTCGTTCTTA TCGGATTATT ATTATTATTA TTATTATTAT TATTATTATT ATTATTATTA TTATTATTAT
TATTATTATT ATTACTACTG TTTCTGCTAT TGTTATTGGT TCGCCTGAAA ATTGGTGTGT CTTTTTTTAA TTTATTATTA
AAAGGTGCAA CTTTGTATGT ATCGCTACAT GCTGTGTTCT TCAATTCTGT TCCATTGTTT ATCTGAGCTC TGTTTGTCCA
ATCCTGGAAT TCCTTCATTG AGTGTTTCCT TGCGTTTTTG AGATGCATTC TTTAAGACGT CACTGTACAA CTCAAGCTAG
GAATATACTG ATTTGAGTGT AATTAATCTG CCTCTCTATC AATAGAAGAG GAAAAAAATA ATAATCTTTT GCTGCTATTT
ACTTCACAAT TTATGCTCAT ATTTCTCAGA AAAAGGCAGT AGTAGTGGAA TACAAGTTGA GATATTCTTC TCACCTGTCA
CTTCAAGATT GATTTTTTTT AACCTTCTAA TTTAGCAGCT AGTAACGACT TCTTGCTTGA CTGCCTTTTC ATGACCAGAT
ATCATTGGCA AAGGCAGCCT GCACATTTGC CTTGAAGGGG TTGAAGAATT GGATGAAACC TGAGAAGGTA GTACTACTAT
TTCTTTTGCA TGTTCAGTCT CCAGTACTAT CCATTAAAAG TTTATTCTTT TGTTGATCAG ATGCTAATCA TGCTAACCCT
CATAAATGAT GATCAGGTAC CTGCCGCCCT CACTACATTC CCATCAACTG CACAAATTGT GTCAGAGCCT CTTGGTGTCG
TCCTAGTCAT CTCAGCATGG AACTACCCTT TCTGTAAGTT AAATGGTGCA TTCATGTTTC ATACTCGTAA TTGCATAAAC
ACCGTTATTC CATAGAGTAA TGCTATTGAG TAGGGATTAA TTGCAATTTT TGGTGAAGGT TGGAAGATAT TGTTTCTATG
GATTAGTTTG TTGCATGATG TCCAAAGTTT GTGTCATGCT TTTTATGTGC TTGAGGATTG GTTGCATTCA TAGTTGGTAT
CTTTCCTTTT CATTGGTACT ATTCTTTTTC AATATTACTC CTTTCCATTG CAATTAACTA TATGAGTCCT TAAAAAAACC
CCACTATCTG TAACAGTTCT CCAGTTCTTC AATATCTGAG CATTAGTTTC AGCACTACTT GAAAAATGGG GATCCTCTTA
TAAATATTCT CCTTTTTCTG TGCACCAAAC ACAAACTTGA GCTTTCTTTT TTGGTCCTTG AGAAAATGAG AAGGCACCTG
CTTTTTTAAG TACTATTAAT ATGTGGTACT ACCTATTGGC ATCTCTACAT TATGAAGGTT CTGTGCGGTA CCGCAAATTA
ACACTAGAAA GGTATCTCCT GTCTTGGTGT AATGAATAAC ATTTTTGGCC TGCTTGCAGA CCTTCGAAAA TTTAAGACAA
GTTCCCAACC CCCACACCAC CACCAAAGGC GGTCCTCACT GGTTCGAATT TCTAATCACC TCACATTTTT CTTTTGTAGT
GCTCTCCATC GACCCAGTCA TAGGAGCAAT TGCTGCTGGG AATGCCGTTG TGCTGAAGCC ATCAGAAATT GCACCAGCCA
CCTCAGCATT GTTCGCCAAG CTGCTACCTG AATACGTTGA TAGCTCTTGC ATAAAAGTGG TGGAGGGAGG CGTTCCAGAA
ACAACCGCAC TCTTAGAACA AAAGTGGGAT AAGATCTTCT ACACAGGTTA ACTTCTTATC TTGCATAGTT TTCCAGTATG
CTAATGATTT TTTTTTTTTT TTGCTTTAGC TGCTGGGTAC TTCACTAAAT TATTCATCCA TTCTGTTTTG CTGTTAAGAC
GCTAAAGTGT AGATATTCCT TTGAAACTGC AGGTAGCGGA AATGTGGGCC GCATAGTGAT GGCAGCAGCT GCAAAGCATC
TTACCCCTGT GGCTCTAGAG CTTGGTGGAA AATGCCCTGC AATTGTTGAT TCTAATACTG ATCTTCATGT AAACATCTGC
TCCTGAACTG TCAAGTCTTT AGATAGTTAC ATATAGAAAC ACTCTTGTTT CTCAAGATCT CCTAACATTT TTCTTCTCCA
TGTAGGTTAC CATGAAGAGG CTAGCTGTTG GCAAGTGGGG ATGTAACAAC GGGCAGGCAT GCATTGCTCC AGACTACGTT
ATAACAACAA AATCATTTGC TCCAGAGCTG GTAAAGAATA CCATGCACAT TAGACCTAAA GAAGTTATAG AGCTAATTAA
AGTCCTATTT GCTTAGCCAT GAAGCTTTCC TTTTTGTAGG TTGACTCTTT AAAAAGAGTT TTGAAAAGGT TCTATGGGGA
GGATCCTTTG CAATCAGAAG ACTTGTCCCG TATTGTGAAT TCTAACCATT TCCGTAGATT GACAAATTTG ATAGAGGATA
AGAAAGTCGC CCAAAAGATT GTATATGGTG GCCAAACAGA TGAGAAGCAA CTGTAAGAAT TTAATTTGAA ATCTGACATT
ACTGTTGGGC TACTAGCAAA AGGAGTTTGA TTGATCTTTA ACACTTTGTT TCCATACATT GCAGAAAAAT AGCTCCTACT
GTGTTGTTAG ATGTTCCTCT TGATACAACA CTCATGGCAG AGGAAATTTT TGGTCCCTTA CTTCCCATTG TAACAGTAAG
TGGTTTTTCT CGGCCTTTGT CATGTTTCTC TTATAATTAA TATCGCGTTA CCTCTTAAAA TTCTCTTAGA ACCATATAAA
ACAGAAGGTT GAAACACATA TACATGAACA TAATTTCCCA AATTAAAGTG AGAAGTGGTA CAATTCCATT AAAAAATGGT
ATTTTCCAGG TTGGTTCTAG TGGCAAAATT AGAGCTATAC TTCTAAGATC TTTGTGTAGT TTCATCATGC CATAATTTTA
TCTCGCCAAG TCAACATATG TTGGCTTTGC TGGTACAATC TTAGTATCTG ATTCTGTTTG GACTGGTTCC TAGGTTGACA
AGATTGAAGA TAGCATCCAG TTCATCAACT CAAGGACCAA GCCACTTGCA GCCTATCTTT TCACCAAGGA CAAGAAACTG
CAAGAGGAAT TTGTGTCCAA TGTCCCAGCA GGAGGAATGC TTGTAAATGA TGTTGCCCTG CATGTAAGTA GTCCTCCTCC
CTGAAACCCT GAACTGAAAG TAACAACATT TGCTCACAGC ATGCTGATCT GATTGATTTT CATCTGCTTT CCACCACAGC
TCGCCAATCC GCACCTGCCA TTTGGCGGAG TCGGCGACAG CGGGATCGGC TCCTACCATG GCAAATTCAG CTTCGATTGT
TTCACCCACA AGAAGGCCGT CCTGATCCGC GGCTTCGGAG GGGAGGCAAC TGCTAGGTAC CCACCTTACA CGATTGAGAA
GCAGAAGATC CTGAGAGGAC TGATAAACGG CAGCTTCTTT GCACTGATTC TTGCCCTCCT GGGCTTCCCC AAAGAGAGGC
GTTAGAAAAC TTTCAGTAGT TTCAGTACAG TACTTGTGCA TTTGAGTGAG TGCAGGCCAT GCTGTCAATG GAAGCCATTT
CCTGCATGTT GTTTTACACA GGTGTACATT ATATTTGTCG GATTTTCTTG TGTAACTTAT TGAAAATTCT ACTACACAGG
GTTACATAAA TAAACATGAT TTGTCAGT

Locus: Os11g0186200

Loading...

Locus: Os11g0186200

Loading...