Os11t0187200-01

Locus

Os11g0187200

Description

GATA zinc finger family protein, Control of heading date, plant height and panicle length

RAP-DB Gene Symbol Synonym(s)

OsGATA28

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA28

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 28

Oryzabase Gene Symbol Synonym(s)

OsGATA28

Oryzabase Gene Name Synonym(s)

GATA transcription factor 28, GATA factor 28

Transcript Evidence

EU972972

Protein Evidence

Q53P56

Literature

PMID: 27322545

PMID: 15084732

Note

Manual Curation

August 31, 2017

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, NHR/GATA-type (IPR013088)

Zinc finger, GATA-type (IPR000679)

Expression Databases

TENOR (Os11t0187200-00)

Others

Oryzabase (20506)

Transcript

1344 bp

>Os11t0187200-01 GATA zinc finger family protein, Control of heading date, plant height and panicle length
GCCGGCCATATGCGCGAATGCCGAAGCCGACTCCCTCCTCCTCCTCCTTCCTCGACTTCA
CCGGCGGCGTCGACGGCGATGACGACGACCCGTCGTGCCCCTTCGAGGGGCTGTGCTGCC
CCGACGACCCGCTCGACCAGGTCCTCAACTTCGACTCCTCCGATTTCGGCCATGTCTTCT
TCGAATCGCTCGACGTCGAGTTGTTCCTGCCGCGTGGTGGGCCCTCACGCGGCGCCGGCG
AGGAGGATAGCAAGGGCGCGGTGGAGCGCGTCGCGTTTGGCTCCAGCGCCGCGGTGGAGA
GCGAGCTCGGCGGCGTTGGCGGCGGCGGCGCGGGTAGCGAGGTGAGCGTGCCTGGTGGCG
CCGGCGGCGGCCGCGGCGAGGACATGGAAACCGAGGCGCTCGACGTGAAGCCCGTGGTTG
GGGTTGGAGCCGGCGGCGCCATGGGCGCGCACGTCGCCGGCGGCGTGGGCGCGCCCGGCG
CTTTCCCCGAAAGCAAGCAGCTGGTGCCCTGGCCGTGCGCGGTTGGCGCCGGCGCGAGCG
CGCCGGGCGCTGCCCCGGACAACCGTCTGCTCGCGTTGCCGGATGTCCGCTTTGACGCGC
TGACCGCGGAAGGCGCGGCTCCCGGCGGCGAACGCGGGAAGACCATACCTGACTCAGTCT
CCAAGAACGGACTCCCGACATTGCCGGGTGTCCGTTCCGCCACGCCCACCGCGCCGCCGG
CCACACCCTTCCGGTTGGAGTGGGATCACGCGGCGGCGCCGTCGAGCAGCGCGACCACGA
CACCCTCGGACTCCAGCCTCTCCTCGCCGCCGTCCTTGTCATCCGTGTTCCCGAGGATCG
CCCGGGTGTTCCCATCCCGGACCAAGCCCAGGAGGCGGCGCACCCTACGCAGGCAGCACT
GGTCGTTGATCTGcccgctccacctcgtgccagtcgccgccgccgccgacgccgcgcgcg
gcaagagcatcagcgagctcaacgcctccgcctccgccgccaccgacgccggcacccctt
ccatcaacgacggcggcggcgGTAGCTACCACCGGCGCGTGGTGGGGCGCCAGCGCAACC
GGCAGGTGAGGAAGGACAGGAGGTGCAGCCACTGCGGCACCTCGGAGACGCCGCAATGGC
GGATGGGCCCGGACGGCCCCGGCACGCTCTGCAACGCGTGCGGCATCAGGAGCAAGATGG
ACAGGCTGCTGCCGGAGTACCGGCCGTCGACGAGCCCCAGCTTCAACGGCGACGAGCACT
CCAACCGCCACAGGAAGGTGTTGAAGCTCAGGGAGAAGAAGGGGCGCGACTAGCTCGCCG
GCCGATCGAGGCGTCGGCGGCGGC

CDS

1296 bp

>Os11t0187200-01 GATA zinc finger family protein, Control of heading date, plant height and panicle length
ATGCCGAAGCCGACTCCCTCCTCCTCCTCCTTCCTCGACTTCACCGGCGGCGTCGACGGC
GATGACGACGACCCGTCGTGCCCCTTCGAGGGGCTGTGCTGCCCCGACGACCCGCTCGAC
CAGGTCCTCAACTTCGACTCCTCCGATTTCGGCCATGTCTTCTTCGAATCGCTCGACGTC
GAGTTGTTCCTGCCGCGTGGTGGGCCCTCACGCGGCGCCGGCGAGGAGGATAGCAAGGGC
GCGGTGGAGCGCGTCGCGTTTGGCTCCAGCGCCGCGGTGGAGAGCGAGCTCGGCGGCGTT
GGCGGCGGCGGCGCGGGTAGCGAGGTGAGCGTGCCTGGTGGCGCCGGCGGCGGCCGCGGC
GAGGACATGGAAACCGAGGCGCTCGACGTGAAGCCCGTGGTTGGGGTTGGAGCCGGCGGC
GCCATGGGCGCGCACGTCGCCGGCGGCGTGGGCGCGCCCGGCGCTTTCCCCGAAAGCAAG
CAGCTGGTGCCCTGGCCGTGCGCGGTTGGCGCCGGCGCGAGCGCGCCGGGCGCTGCCCCG
GACAACCGTCTGCTCGCGTTGCCGGATGTCCGCTTTGACGCGCTGACCGCGGAAGGCGCG
GCTCCCGGCGGCGAACGCGGGAAGACCATACCTGACTCAGTCTCCAAGAACGGACTCCCG
ACATTGCCGGGTGTCCGTTCCGCCACGCCCACCGCGCCGCCGGCCACACCCTTCCGGTTG
GAGTGGGATCACGCGGCGGCGCCGTCGAGCAGCGCGACCACGACACCCTCGGACTCCAGC
CTCTCCTCGCCGCCGTCCTTGTCATCCGTGTTCCCGAGGATCGCCCGGGTGTTCCCATCC
CGGACCAAGCCCAGGAGGCGGCGCACCCTACGCAGGCAGCACTGGTCGTTGATCTGcccg
ctccacctcgtgccagtcgccgccgccgccgacgccgcgcgcggcaagagcatcagcgag
ctcaacgcctccgcctccgccgccaccgacgccggcaccccttccatcaacgacggcggc
ggcgGTAGCTACCACCGGCGCGTGGTGGGGCGCCAGCGCAACCGGCAGGTGAGGAAGGAC
AGGAGGTGCAGCCACTGCGGCACCTCGGAGACGCCGCAATGGCGGATGGGCCCGGACGGC
CCCGGCACGCTCTGCAACGCGTGCGGCATCAGGAGCAAGATGGACAGGCTGCTGCCGGAG
TACCGGCCGTCGACGAGCCCCAGCTTCAACGGCGACGAGCACTCCAACCGCCACAGGAAG
GTGTTGAAGCTCAGGGAGAAGAAGGGGCGCGACTAG

Protein

432 aa

>Os11t0187200-01 GATA zinc finger family protein, Control of heading date, plant height and panicle length
MPKPTPSSSSFLDFTGGVDGDDDDPSCPFEGLCCPDDPLDQVLNFDSSDFGHVFFESLDV
ELFLPRGGPSRGAGEEDSKGAVERVAFGSSAAVESELGGVGGGGAGSEVSVPGGAGGGRG
EDMETEALDVKPVVGVGAGGAMGAHVAGGVGAPGAFPESKQLVPWPCAVGAGASAPGAAP
DNRLLALPDVRFDALTAEGAAPGGERGKTIPDSVSKNGLPTLPGVRSATPTAPPATPFRL
EWDHAAAPSSSATTTPSDSSLSSPPSLSSVFPRIARVFPSRTKPRRRRTLRRQHWSLICP
LHLVPVAAAADAARGKSISELNASASAATDAGTPSINDGGGGSYHRRVVGRQRNRQVRKD
RRCSHCGTSETPQWRMGPDGPGTLCNACGIRSKMDRLLPEYRPSTSPSFNGDEHSNRHRK
VLKLREKKGRD*

5'UTR

chr11:4434072..4434088 (- strand) : 17 bp

CDS

chr11:4432776..4434071 (- strand) : 1296 bp

3'UTR

chr11:4432745..4432775 (- strand) : 31 bp

FASTA

>Os11t0187200-01 class=Sequence position=chr11:4432745..4434088 (- strand)
GCCGGCCATA TGCGCGAATG CCGAAGCCGA CTCCCTCCTC CTCCTCCTTC CTCGACTTCA CCGGCGGCGT CGACGGCGAT
GACGACGACC CGTCGTGCCC CTTCGAGGGG CTGTGCTGCC CCGACGACCC GCTCGACCAG GTCCTCAACT TCGACTCCTC
CGATTTCGGC CATGTCTTCT TCGAATCGCT CGACGTCGAG TTGTTCCTGC CGCGTGGTGG GCCCTCACGC GGCGCCGGCG
AGGAGGATAG CAAGGGCGCG GTGGAGCGCG TCGCGTTTGG CTCCAGCGCC GCGGTGGAGA GCGAGCTCGG CGGCGTTGGC
GGCGGCGGCG CGGGTAGCGA GGTGAGCGTG CCTGGTGGCG CCGGCGGCGG CCGCGGCGAG GACATGGAAA CCGAGGCGCT
CGACGTGAAG CCCGTGGTTG GGGTTGGAGC CGGCGGCGCC ATGGGCGCGC ACGTCGCCGG CGGCGTGGGC GCGCCCGGCG
CTTTCCCCGA AAGCAAGCAG CTGGTGCCCT GGCCGTGCGC GGTTGGCGCC GGCGCGAGCG CGCCGGGCGC TGCCCCGGAC
AACCGTCTGC TCGCGTTGCC GGATGTCCGC TTTGACGCGC TGACCGCGGA AGGCGCGGCT CCCGGCGGCG AACGCGGGAA
GACCATACCT GACTCAGTCT CCAAGAACGG ACTCCCGACA TTGCCGGGTG TCCGTTCCGC CACGCCCACC GCGCCGCCGG
CCACACCCTT CCGGTTGGAG TGGGATCACG CGGCGGCGCC GTCGAGCAGC GCGACCACGA CACCCTCGGA CTCCAGCCTC
TCCTCGCCGC CGTCCTTGTC ATCCGTGTTC CCGAGGATCG CCCGGGTGTT CCCATCCCGG ACCAAGCCCA GGAGGCGGCG
CACCCTACGC AGGCAGCACT GGTCGTTGAT CTGcccgctc cacctcgtgc cagtcgccgc cgccgccgac gccgcgcgcg
gcaagagcat cagcgagctc aacgcctccg cctccgccgc caccgacgcc ggcacccctt ccatcaacga cggcggcggc
gGTAGCTACC ACCGGCGCGT GGTGGGGCGC CAGCGCAACC GGCAGGTGAG GAAGGACAGG AGGTGCAGCC ACTGCGGCAC
CTCGGAGACG CCGCAATGGC GGATGGGCCC GGACGGCCCC GGCACGCTCT GCAACGCGTG CGGCATCAGG AGCAAGATGG
ACAGGCTGCT GCCGGAGTAC CGGCCGTCGA CGAGCCCCAG CTTCAACGGC GACGAGCACT CCAACCGCCA CAGGAAGGTG
TTGAAGCTCA GGGAGAAGAA GGGGCGCGAC TAGCTCGCCG GCCGATCGAG GCGTCGGCGG CGGC